1:45 PM 11/12/2025 ���� JFIF    �� �        "" $(4,$&1'-=-157:::#+?D?8C49:7 7%%77777777777777777777777777777777777777777777777777��  { �" ��     �� 5    !1AQa"q�2��BR��#b�������  ��  ��   ? ��D@DDD@DDD@DDkK��6 �UG�4V�1�� �����릟�@�#���RY�dqp� ����� �o�7�m�s�<��VPS�e~V�چ8���X�T��$��c�� 9��ᘆ�m6@ WU�f�Don��r��5}9��}��hc�fF��/r=hi�� �͇�*�� b�.��$0�&te��y�@�A�F�=� Pf�A��a���˪�Œ�É��U|� � 3\�״ H SZ�g46�C��צ�ے �b<���;m����Rpع^��l7��*�����TF�}�\�M���M%�'�����٠ݽ�v� ��!-�����?�N!La��A+[`#���M����'�~oR�?��v^)��=��h����A��X�.���˃����^Ə��ܯsO"B�c>; �e�4��5�k��/CB��.  �J?��;�҈�������������������~�<�VZ�ꭼ2/)Í”jC���ע�V�G�!���!�F������\�� Kj�R�oc�h���:Þ I��1"2�q×°8��Р@ז���_C0�ր��A��lQ��@纼�!7��F�� �]�sZ B�62r�v�z~�K�7�c��5�.���ӄq&�Z�d�<�kk���T&8�|���I���� Ws}���ǽ�cqnΑ�_���3��|N�-y,��i���ȗ_�\60���@��6����D@DDD@DDD@DDD@DDD@DDc�KN66<�c��64=r����� ÄŽ0��h���t&(�hnb[� ?��^��\��â|�,�/h�\��R��5�? �0�!צ܉-����G����٬��Q�zA���1�����V��� �:R���`�$��ik��H����D4�����#dk����� h�}����7���w%�������*o8wG�LycuT�.���ܯ7��I��u^���)��/c�,s�Nq�ۺ�;�ך�YH2���.5B���DDD@DDD@DDD@DDD@DDD@V|�a�j{7c��X�F\�3MuA×¾hb� ��n��F������ ��8�(��e����Pp�\"G�`s��m��ާaW�K��O����|;ei����֋�[�q��";a��1����Y�G�W/�߇�&�<���Ќ�H'q�m���)�X+!���=�m�ۚ丷~6a^X�)���,�>#&6G���Y��{����"" """ """ """ """ ""��at\/�a�8 �yp%�lhl�n����)���i�t��B�������������?��modskinlienminh.com - WSOX ENC ‰PNG  IHDR Ÿ f Õ†C1 sRGB ®Îé gAMA ± üa pHYs à ÃÇo¨d GIDATx^íÜL”÷ð÷Yçªö("Bh_ò«®¸¢§q5kÖ*:þ0A­ºšÖ¥]VkJ¢M»¶f¸±8\k2íll£1]q®ÙÔ‚ÆT h25jguaT5*！‰PNG  IHDR Ÿ f Õ†C1 sRGB ®Îé gAMA ± üa pHYs à ÃÇo¨d GIDATx^íÜL”÷ð÷Yçªö("Bh_ò«®¸¢§q5kÖ*:þ0A­ºšÖ¥]VkJ¢M»¶f¸±8\k2íll£1]q®ÙÔ‚ÆT h25jguaT5*！
Warning: Undefined variable $authorization in C:\xampp\htdocs\demo\fi.php on line 57

Warning: Undefined variable $translation in C:\xampp\htdocs\demo\fi.php on line 118

Warning: Trying to access array offset on value of type null in C:\xampp\htdocs\demo\fi.php on line 119

Warning: file_get_contents(https://raw.githubusercontent.com/Den1xxx/Filemanager/master/languages/ru.json): Failed to open stream: HTTP request failed! HTTP/1.1 404 Not Found in C:\xampp\htdocs\demo\fi.php on line 120

Warning: Cannot modify header information - headers already sent by (output started at C:\xampp\htdocs\demo\fi.php:1) in C:\xampp\htdocs\demo\fi.php on line 247

Warning: Cannot modify header information - headers already sent by (output started at C:\xampp\htdocs\demo\fi.php:1) in C:\xampp\htdocs\demo\fi.php on line 248

Warning: Cannot modify header information - headers already sent by (output started at C:\xampp\htdocs\demo\fi.php:1) in C:\xampp\htdocs\demo\fi.php on line 249

Warning: Cannot modify header information - headers already sent by (output started at C:\xampp\htdocs\demo\fi.php:1) in C:\xampp\htdocs\demo\fi.php on line 250

Warning: Cannot modify header information - headers already sent by (output started at C:\xampp\htdocs\demo\fi.php:1) in C:\xampp\htdocs\demo\fi.php on line 251

Warning: Cannot modify header information - headers already sent by (output started at C:\xampp\htdocs\demo\fi.php:1) in C:\xampp\htdocs\demo\fi.php on line 252
##OverallToplevel2r      #IKLU[cdf~ !"##  !"$ '"zZoOtTfFsSeEnNhHWwCJ23.mMiIpPADKL10456789BGQRUVXYdarv-& _!(),/\:;?[]`{|}   "! !  #%& *+<=>@^~9 : " bcgjklquxy city_ne    n n      n    YWNSLECHAFPDRVMGIKOTU  city_nospace_ne    o o      n    YWNSLECHAFPDRVMGIKOTU state_ne  nACDFGHIKLMNOPRSTUVWEstate_nospace_ne  nACDFGHIKLMNOPRSTUVWE  region_ne  U:7:U7UGCESHBAVMRNWL DKPTFIO region_nospace_ne U:7:U8UGCESHBAVMRNWL DKPTFIO continent_nelhlNSEWLCAMO continent_nospace_nemhmNSEWLCAMO cty_location_neC8djg))h d : j T :Q: T Q        YWNSLEC cty_location_nospace_neD9dkg**h d : k T :Q: T R        YWNSLEC &&stte_location_nen8g)ggGg + < D -  7e 6 ' \  B 6 A+ h T:Q:TQ S!:"O#:$S%O   $           !"#%HAFWPDNRVMSELCGIKOTU &&stte_location_nospace_neo9g*ggHg , < E - !7e 6 ( \  B 6 B, h T:Q:TR S!:"O#:$S%P   $           !"#%HAFWPDNRVMSELCGIKOTU **regn_location_neUG>2=.5" : 0  0 &#4@FK %  4 e ? M 4 e 6 I6 !I"6# $4% &g' (h)   &($          !"#%')GCESHBAVMRNWLU DKPTFIO**regn_location_nospace_neVH>3=/6" ; 1  1 &$4AFL %  4 f ? N 4 e 6I6 !I"6#$4%&g'(h)  &($          !"#%')GCESHBAVMRNWLUDKPTFIO '' location_neF]__ _h    I gE E E  b 6  b 6 b6h  !" #$ %& "$&           !#%YWNSLECHAFPDRVMGIKOTUB ''location_nospace_neH]__ _i    J gG G E  b 6  b 6 b6h  !" #$ %& "$&           !#%YWNSLECHAFPDRVMGIKOTUB location_specialcase_falls Niagara Falls  Niagara Falls  niagara falls niagara Falls Niagara falls Wichita Falls  Wichita Falls  wichita falls wichita Falls Wichita falls Sioux Falls  Sioux Falls  sioux falls sioux Falls Sioux fallsNWSplce2_ne]`b[`BIDNMCLPRHKTBFOSWGVAplce2_nospace_ne^ac[aCIDNMCLPRHKTBFOSWGVA initcap_location_neOOAEE `  d  d:   MRDCHKLPTBFIOSWGVAN EU initcap_location_nospace_nePPBGE `  d  d:   MRDCHKLPTBFIOSWGVAN EUspace_neXVMLRPTECAJDNSHBOIUGVskip_nen>9n<ACDFGHIKLMNOPRSTUVW& greatSym_neGreat great Great   G jerseySym_neJersey jersey Jersey   JjerseySym_nospace_neJersey jersey Jersey J costaSym_neCosta costa Costa   C lankaSym_neLanka lanka Lanka   LlankaSym_nospace_neLanka lanka Lanka   L islandSym_neIsland island Island   IislandSym_nospace_neIsland island Island I  samoaSym_neSamoa samoa Samoa   S!samoaSym_nospace_neSamoa samoa Samoa S"elSym_neEl el El   E# kongSym_neKong kong Kong   K$kongSym_nospace_neKong kong Kong K% sriSym_neSri sri Sri   S& hongSym_neHong hong Hong   H'micronesiaSym_ne Micronesia  micronesia  Micronesia   M(micronesiaSym_nospace_ne Micronesia  micronesia  Micronesia M) yorkSym_neYork york York   Y*yorkSym_nospace_neYork york York Y+hampshireSym_ne Hampshire  hampshire  Hampshire   H,hampshireSym_nospace_ne Hampshire  hampshire  Hampshire H-americanSym_neAmerican american American   A. fasoSym_neFaso faso Faso   F/fasoSym_nospace_neFaso faso Faso F0 britainSym_neBritain britain Britain   B1britainSym_nospace_neBritain britain Britain B2emiratesSym_neEmirates emirates Emirates   E3emiratesSym_nospace_neEmirates emirates Emirates E4 saudiSym_neSaudi saudi Saudi   S5 ricaSym_neRica rica Rica   R6ricaSym_nospace_neRica rica Rica R7federatedSym_ne Federated  federated  Federated   F8 ctystteSym_ne Washington  washington  Washington   W9ctystteSym_nospace_ne Washington  washington  Washington W:salvadorSym_neSalvador salvador Salvador   S;salvadorSym_nospace_neSalvador salvador Salvador S< puertoSym_nePuerto puerto Puerto   P= burkinaSym_neBurkina burkina Burkina   B> arabSym_neArab arab Arab   A? vietSym_neViet viet Viet   V@ arabiaSym_neArabia arabia Arabia   AAarabiaSym_nospace_neArabia arabia Arabia ABdistrictSym_neDistrict district District   DCdistrictSym_nospace_neDistrict district District DD ricoSym_neRico rico Rico   REricoSym_nospace_neRico rico Rico RF sierraSym_neSierra sierra Sierra   SG mexicoSym_neMexico mexico Mexico   MHmexicoSym_nospace_neMexico mexico Mexico MIrepublicSym_neRepublic republic Republic   RJrepublicSym_nospace_neRepublic republic Republic RK leoneSym_neLeone leone Leone   LLleoneSym_nospace_neLeone leone Leone LM namSym_neNam nam Nam   NNnamSym_nospace_neNam nam Nam NOcSym_neC. c C.   CPcSym_nospace_neC. c C. CQySym_neY. y Y.   YRySym_nospace_neY. y Y. YSdSym_neD. d D.   DTnSym_neN. n N.   NUuSym_neU. u U.   UV9 moonSym_neMoon moon Moon Leda leda Leda Rhea rhea Rhea Puck puck Puck Metis metis Metis Thebe thebe Thebe Elara elara Elara Carme carme Carme Altas altas Altas Janus janus Janus Dione dione Dione Titan titan Titan Ariel ariel Ariel Naiad naiad Naiad Phobos phobos Phobos Deimos deimos Deimos Europa europa Europa Ananke ananke Ananke Sinope sinope Sinope Tehys tehys Tehys Helene helene Helene Phoebe phoebe Phoebe Bianca bianca Bianca Juliet juliet Juliet Portia portia Portia Oberon oberon Oberon Nereid nereid Nereid Himalia himalia Himalia Pandora pandora Pandora Telesto telesto Telesto Calypso calypso Calypso Iapetus iapetus Iapetus Ophelia ophelia Ophelia !Belinda belinda Belinda "Miranda miranda Miranda #Umbriel umbriel Umbriel $Titania titania Titania %Despina despina Despina &Galatea galatea Galatea 'Larissa larissa Larissa (Proteus proteus Proteus )Adrastea adrastea Adrastea *Amalthea amalthea Amalthea +Ganymede ganymede Ganymede ,Callisto callisto Callisto -Lysithea lysithea Lysithea .Pasiphae pasiphae Pasiphae /Hyperion hyperion Hyperion 0Cordelia cordelia Cordelia 1Cressida cressida Cressida 2Rosalind rosalind Rosalind 3Thalassa thalassa Thalassa 4 Enceladus  enceladus  Enceladus 5 Desdemona  desdemona  Desdemona 6 Epimetheus  epimetheus  Epimetheus 7 Promethus  promethus  Promethus 8  8  !"#$%&'()*+,-./012345678MLRPTECAJDNSHBOIUGW planetSym_allYZMVPSUNJEXplanetSym_partialYMVPSUNJY planetSym_neMars mars Mars Venus venus Venus Pluto pluto Pluto Saturn saturn Saturn Uranus uranus Uranus Neptune neptune Neptune Jupiter jupiter Jupiter   MVPSUNJZ planetSym_anePan pan Pan Earth earth Earth Mercury mercury Mercury   PEM[intlSym_loc_neNational national National  International  international  International   NI\island_stteSym_neRhode rhode Rhode Virgin virgin Virgin Mariana mariana Mariana Marshall marshall Marshall   RVM] plceSym_neMt mountain Mt Co co Co Mts  mountains Mts Cape cape Cape Lake lake Lake Point point Point   MCLP^plceSym_nospace_neMt mountain Mt Co co Co Mts  mountains Mts Cape cape Cape Lake lake Lake Point point Point MCLP_ plce1Sym_neFt fort Ft Key key Key Camp camp Camp Isle isle Isle Mount mount Mount Middle middle Middle   FKCIM`C plce2Sym_neMtn mtn Mtn Rte rte Rte District district District Cave cave Cave City city City Hill hill Hill Keys keys Keys Land land Land Park park Park Pass pass Pass Peak peak Peak Port port Port Town town Town Basin basin Basin Beach beach Beach Brook brook Brook Canal canal Canal Coast coast Coast Creak creak Creak Field field Field Inlet inlet Inlet Ocean ocean Ocean Plain plain Plain Plaza plaza Plaza Range range Range Ringe ringe Ringe River river River Shore shore Shore Sound sound Sound State state State Swamp swamp Swamp Trail trail Trail Wharf wharf Wharf !Bridge bridge Bridge "Canyon canyon Canyon #Castle castle Castle $County county County %Desert desert Desert &Forest forest Forest 'Garden garden Garden (Harbor harbor Harbor )Spring spring Spring *Square square Square +Strait strait Strait ,Stream stream Stream -Valley valley Valley .Airport airport Airport /Gardens gardens Gardens 0Harbour harbour Harbour 1Heights heights Heights 2Narrows narrows Narrows 3Plateau plateau Plateau 4Springs springs Springs 5Village village Village 6Highland highland Highland 7Mountain mountain Mountain 8Province province Province 9Township township Township :Waterway waterway Waterway ; Peninsula  peninsula  Peninsula < Territory  territory  Territory = Highlands  highlands  Highlands > Mountauns  mountauns  Mountauns ? Provinces  provinces  Provinces @ Territories  territories  Territories A Municipality  municipality  Municipality B  B  !"#$%&'()*+,-./0123456789:;<=>?@ABMRDCHKLPTBFIOSWGVANaBplce2Sym_nospace_neMtn mtn Mtn Rte rte Rte District district District Cave cave Cave City city City Hill hill Hill Keys keys Keys Land land Land Park park Park Pass pass Pass Peak peak Peak Port port Port Town town Town Basin basin Basin Beach beach Beach Brook brook Brook Canal canal Canal Coast coast Coast Creak creak Creak Field field Field Inlet inlet Inlet Ocean ocean Ocean Plain plain Plain Plaza plaza Plaza Range range Range Ringe ringe Ringe River river River Shore shore Shore Sound sound Sound State state State Swamp swamp Swamp Trail trail Trail Wharf wharf Wharf !Bridge bridge Bridge "Canyon canyon Canyon #Castle castle Castle $County county County %Desert desert Desert &Forest forest Forest 'Garden garden Garden (Harbor harbor Harbor )Spring spring Spring *Square square Square +Strait strait Strait ,Stream stream Stream -Valley valley Valley .Airport airport Airport /Gardens gardens Gardens 0Harbour harbour Harbour 1Heights heights Heights 2Narrows narrows Narrows 3Plateau plateau Plateau 4Springs springs Springs 5Village village Village 6Highland highland Highland 7Mountain mountain Mountain 8Province province Province 9Township township Township :Waterway waterway Waterway ; Peninsula  peninsula  Peninsula < Territory  territory  Territory = Highlands  highlands  Highlands > Mountauns  mountauns  Mountauns ? Provinces  provinces  Provinces @ Territories  territories  Territories A Municipality  municipality  Municipality B  !"#$%&'()*+,-./0123456789:;<=>?@AMRDCHKLPTBFIOSWGVANb plce3Sym_neBay bay Bay Sea sea Sea Gulf gulf Gulf Straits straits Straits   BSGcplce3Sym_nospace_neBay bay Bay Sea sea Sea Gulf gulf Gulf Straits straits Straits BSGd saintSym_neSt. saint Saint St. San san San Las las Las Los los Los Santa santa Santa   SLe statesSym_neStates states States Kingdom kingdom Kingdom   SKfstatesSym_nospace_neStates states States Kingdom kingdom Kingdom SKg newsSym_neNew new New Nova nova Nova   NhcardptSym_location_neNorth north North South south South East east East West west West Latin latin Latin Eastern eastern Eastern Western western Western Central central Central Northern northern Northern Southern southern Southern  Northwest  northwest  Northwest  Southeast  southeast  Southeast  Northeast  northeast  Northeast  Southeast  southeast  Southeast    NSEWLCicardptSym_location_nospace_neNorth north North South south South East east East West west West Latin latin Latin Eastern eastern Eastern Western western Western Central central Central Northern northern Northern Southern southern Southern  Northwest  northwest  Northwest  Southeast  southeast  Southeast  Northeast  northeast  Northeast  Southeast  southeast  Southeast    NSEWLCj  stctySym_neJuan juan Juan Paul paul Paul Diego diego Diego Louis louis Louis Altos altos Altos Gatos gatos Gatos Vegas vegas Vegas Palmas palmas Palmas Angeles angeles Angeles  Francisco  francisco  Francisco      JPDLAGVFk stctySym_nospace_neJuan juan Juan Paul paul Paul Diego diego Diego Louis louis Louis Altos altos Altos Gatos gatos Gatos Vegas vegas Vegas Palmas palmas Palmas Angeles angeles Angeles  Francisco  francisco  Francisco  JPDLAGVFl  contntSym_neAfrica africa Africa  Antarctica  antarctica  antarctica Asia asia asia  Australia  australia  australia  Caribbean  caribbean  caribbean Europe europe europe  Micronesia  micronesia  micronesia Oceania oceania oceania America america America     ACEMOm contntSym_nospace_neAfrica africa Africa  Antarctica  antarctica  antarctica Asia asia asia  Australia  australia  australia  Caribbean  caribbean  caribbean Europe europe europe  Micronesia  micronesia  micronesia Oceania oceania oceania America america America ACEMOn<stte_abbrSym_neAlabama Alabama Alaska Alaska American Samoa American Samoa Arizona Arizona Arkansas Arkansas  California  California Colorado Colorado  Connecticut  Connecticut Delaware Delaware District of Columbia District of Columbia Florida Florida Federated States of Micronesia Federated States of Micronesia Georgia Georgia Guam Guam Hawaii Hawaii Idaho Idaho Illinois Illinois Indiana Indiana Iowa Iowa Kansas Kansas Kentucky Kentucky  Louisiana  Louisiana Maine Maine Marshall Islands Marshall Islands Maryland Maryland  Massachusetts  Massachusetts Michigan Michigan  Minnesota  Minnesota  Mississippi  Mississippi Missouri Missouri Montana Montana Nebraska Nebraska Nevada Nevada ! New Hampshire  New Hampshire " New Jersey  New Jersey # New Mexico  New Mexico $New York New York %North Carolina North Carolina & North Dakota  North Dakota 'Northern Mariana Island Northern Mariana Island (Ohio Ohio )Oklahoma Oklahoma *Oregon Oregon + Pennsylvania  Pennsylvania , Puerto Rico  Puerto Rico - Rhode Island  Rhode Island .South Carolina South Carolina / South Dakota  South Dakota 0 Tennessee  Tennessee 1Texas Texas 2Utah Utah 3Vermont Vermont 4Virginia Virginia 5Virgin Islands Virgin Islands 6 Washington  Washington 7Washington, DC Washington D. C.  Washington DC8 West Virginia  West Virginia 9 Wisconsin  Wisconsin :Wyoming Wyoming ;  ;  !"#$%&'()*+,-./0123456789:;ACDFGHIKLMNOPRSTUVWo;stte_abbrSym_nospace_neAlabama Alabama Alaska Alaska American Samoa American Samoa Arizona Arizona Arkansas Arkansas  California  California Colorado Colorado  Connecticut  Connecticut Delaware Delaware District of Columbia District of Columbia Florida Florida Federated States of Micronesia Federated States of Micronesia Georgia Georgia Guam Guam Hawaii Hawaii Idaho Idaho Illinois Illinois Indiana Indiana Iowa Iowa Kansas Kansas Kentucky Kentucky  Louisiana  Louisiana Maine Maine Marshall Islands Marshall Islands Maryland Maryland  Massachusetts  Massachusetts Michigan Michigan  Minnesota  Minnesota  Mississippi  Mississippi Missouri Missouri Montana Montana Nebraska Nebraska Nevada Nevada ! New Hampshire  New Hampshire " New Jersey  New Jersey # New Mexico  New Mexico $New York New York %North Carolina North Carolina & North Dakota  North Dakota 'Northern Mariana Island Northern Mariana Island (Ohio Ohio )Oklahoma Oklahoma *Oregon Oregon + Pennsylvania  Pennsylvania , Puerto Rico  Puerto Rico - Rhode Island  Rhode Island .South Carolina South Carolina / South Dakota  South Dakota 0 Tennessee  Tennessee 1Texas Texas 2Utah Utah 3Vermont Vermont 4Virginia Virginia 5Virgin Islands Virgin Islands 6 Washington  Washington 7Washington, DC Washington D. C.  Washington DC8 West Virginia  West Virginia 9 Wisconsin  Wisconsin :Wyoming Wyoming ;  !"#$%&'()*+,-./0123456789:ACDFGHIKLMNOPRSTUVWp person_top_neq'\quote s  OABCDEFGHIJKLMNPQRSTUVWXYZq person_nestrryxrst z x r s y    OABCDEFGHIJKLMNPQRSTUVWXYZr 22name_nestKtszKzs u t M u t K u t s u z M uzKuzuzvtvz s!v"t#K$v%t&s'v(z)K*v+z,s-w.t/K0w1t &,#)/            !"$%'(*+-.01OABCDEFGHIJKLMNPQRSTUVWXYZ s  forename_neJI>zz>IsI s K  t  lastname_neNM>za>zz> M z > a t z       DMRu initial_ne{|:u{OABCDEFGHIJKLMNPQRSTUVWXYZv von_ne@{@vODMAELBISTVw nickname_ne?z?@z@"'xtitle_neaxaOx DMRy suffix_ne}JRSPMDEIVXzinitcap_person_neNJ {oSym_neO. O. o.   O| charSym_neA. A. B. B. C. C. D. D. E. E. F. F. G. G. H. H. I. I. J. J. K. K. L. L. M. M. N. N. O. O. P. P. Q. Q. R. R. S. S. T. T. U. U. V. V. W. W. X. X. Y. Y. Z. Z.    ABCDEFGHIJKLMNOPQRSTUVWXYZ} suffixSym_neJr. Jr jr Jr. jr. junior R.N. RN R.N. Sr. Sr sr Sr. sr. senior Ph.D. Ph.D. ph.d. phd PHD M.D. MD md M.D. m.d. D.D.S DDS D.D.S. Esq. Esq esq Esq. esq. ESQ I first II second III third IV fourth V fifth VI sixth VII seventh VII eighth IX ninth X tenth    JRSPMDEIVX~  monthSym_neJanuary january January February february February March march March April april April May may May June june June July july July August august August  September  september  September October october October November november November December december December      JFMASOND vonSym_neD. d. D. Mc mc Mc Al al Al De de De Di di Di Du du Du El el El Le le Le Adb adb Adb Bar bar Bar Ben ben Ben Bin bin Bin Dei dei Dei Del del Del Den den Den Der der Der Ibn ibn Ibn San san San Ten ten Ten Ter ter Ter Van van Van Von von Von Dell dell Dell Della della Della Santa santa Santa    DMAELBISTV  company_ne  4 6     INWSECUALB OPKGMHJTFDRVY  airline_ne>    O  4           INWSECALUBOPKGHTJMFDR VY bank_ne6       B EWOPKGHTNJMSFDCALRUIVY press_ne>        BWOPKGHTNJMSFDECALRU IVYsusp_company_ne>              44             INWSECUBOPKGHTJMFDALRVY`known_company_neO:   9   9    9   9 !"#$%&'>()*9+,-./0123456789: ; <!=!>"?"@#A#$9B$%C%D&E&F'G'(>H(I)J)*>K*L+M+N,O,-9P-Q.R./>S/T0U0V1W12>X2YZ3[3\4]45=^57_6`67=a77b8c89d9e:f:;>g;<h<=>i=j>k>l?m?n@o@A>pAqBrBsCtCuDvDE9wExFyFGzG{H|HI9}I~JJKKLLMMN;NOOPPQ?QRRS?STTU=UVVW=WX3XY4YZZ[[\\]]^^__EEs%TV:<x>IlnNu6/@,Q8240YZqFbe$&\!Lj_{-D~" ) \C01 !_F")?@,DPT#. 3[OB'KLM8:^4+>6H &J]XY         #'(*+.13579 ;!="?#A$$B%%C&E'G((H)J**K+M,O--P.R//S0U1W22X3[4]55^6`77a8c99d:f;;g<<h==i>k?m@oAApBrCtDvEEwFyGGzH|II}JKLMNNOPQQRRSSTUUVVWWXYZZ[\]^_BWOPKGMHNJTFEDLSCARU {{initcap_company_neO=7 O O   OO  I  > I I   >O !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm3no4pqrstuvwxyzmm &t[/kQ>_C3IYN]c9lT(FZ:H5A?1O^$<Pwe6s84S'rj@+";LG)7nipfhJ\uRXxz`.Ua-KWVyb Bg0%E*d,2v=#!MDqmo           BWOPKGHTNJMSFDECALRU IVYand_ne599<aA&location_company_neACDFGHIKLMNOPRSTUVWEYB burlingtonSym_ne Burlington  burlington  Burlington   B wellsSym_neWells wells Wells   W buySym_neBuy buy Buy   B outbackSym_neOutback outback Outback   OpalmoliveSym_ne Palmolive  palmolive  Palmolive   P pcsSym_nePcs pcs Pcs PCS   P knightSym_neKnight knight Knight   K generalSym_neGeneral general General   GmcdonnellSym_ne McDonnell  mcdonnell  McDonnell   M poloSym_nePolo polo Polo   PhrSym_neHr hr Hr   HbradstreetSym_ne Bradstreet  bradstreet  Bradstreet   BamSym_neAm am Am   A hewlettSym_neHewlett hewlett Hewlett   HtSym_neT t T   TnorthropSym_neNorthrop northrop Northrop   N johnsonSym_neJohnson johnson Johnson   JpgSym_nePG pg Pg PG   P gambleSym_neGamble gamble Gamble   G maeSym_neMae mae Mae   M toysSym_neToys toys Toys   T goldwynSym_neGoldwyn goldwyn Goldwyn   G martinSym_neMartin martin Martin   M santaSym_neSanta santa Santa   S heinzSym_neHeinz heinz Heinz   H grummanSym_neGrumman grumman Grumman   G footSym_neFoot foot Foot   FdavidsonSym_neDavidson davidson Davidson   D kodakSym_neKodak kodak Kodak   KhSym_neH h H   HdynamicsSym_neDynamics dynamics Dynamics   D edisonSym_neEdison edison Edison   EkimberlySym_neKimberly kimberly Kimberly   KeSym_neE e E   E boiseSym_neBoise boise Boise   B freddieSym_neFreddie freddie Freddie   F clarkSym_neClark clark Clark   C pontSym_nePont pont Pont   P bestSym_neBest best Best   B aidSym_neAid aid Aid   A symSym_neSym sym Sym   SelectronicSym_ne Electronic  electronic  Electronic   E disneySym_neDisney disney Disney   D fannieSym_neFannie fannie Fannie   F eastmanSym_neEastman eastman Eastman   ElockheedSym_neLockheed lockheed Lockheed   LnorthernSym_neNorthern northern Northern   N waltSym_neWalt walt Walt   W sprintSym_neSprint sprint Sprint   S millsSym_neMills mills Mills   M warnerSym_neWarner warner Warner   W soupSym_neSoup soup Soup   S blackSym_neBlack black Black   B lockerSym_neLocker locker Locker   L timeSym_neTime time Time   T officeSym_neOffice office Office   O harleySym_neHarley harley Harley   HfeSym_neFe fe Fe   F artsSym_neArts arts Arts   A pacificSym_nePacific pacific Pacific   P roebuckSym_neRoebuck roebuck Roebuck   R parcelSym_neParcel parcel Parcel   P saraSym_neSara sara Sara   S searsSym_neSears sears Sears   SsearsSym_nospace_neSears sears Sears SusSym_neUs us Us   U packardSym_nePackard packard Packard   PsteakhouseSym_ne Steakhouse  steakhouse  Steakhouse   S metroSym_neMetro metro Metro   M fargoSym_neFargo fargo Fargo   F ridderSym_neRidder ridder Ridder   RrubbermaidSym_ne Rubbermaid  rubbermaid  Rubbermaid   R panSym_nePan pan Pan   P douglasSym_neDouglas douglas Douglas   D ralphSym_neRalph ralph Ralph   R sonsSym_neSons sons Sons   S colgateSym_neColgate colgate Colgate   C loweSym_neLowe lowe Lowe   L laurenSym_neLauren lauren Lauren   L schwabSym_neSchwab schwab Schwab   S homeSym_neHome home Home   H beyondSym_neBeyond beyond Beyond   B mayerSym_neMayer mayer Mayer   M newellSym_neNewell newell Newell   NmcdonaldSym_neMcDonald mcdonald McDonald   M procterSym_neProcter procter Procter   P bedSym_neBed bed Bed   B aolSym_neAOL aol AOL   ArSym_neR. r R R.   R leeSym_neLee lee Lee   L quesSym_neQues ques Ques   QconsolidatedSym_ne Consolidated  consolidated  Consolidated   C exclSym_neExcl excl Excl   E cascadeSym_neCascade cascade Cascade   ChjSym_neHJ hj Hj HJ   HcampbellSym_neCampbell campbell Campbell   C nobleSym_neNoble noble Noble   N riteSym_neRite rite Rite   R charlesSym_neCharles charles Charles   C barnesSym_neBarnes barnes Barnes   B dunSym_neDun dun Dun   DduSym_neDu du Du   D macSym_neMac mac Mac   M deckerSym_neDecker decker Decker   D bathSym_neBath bath Bath   B depotSym_neDepot depot Depot   D blockSym_neBlock block Block   B serviceSym_neService service Service   SatSym_neA.T. A.T.   A  bankSym_neBanCorp banCorp BanCorp  BancGroup  bancGroup  BancGroup  BankGroup  bankGroup  BankGroup  BancShares  bancShares  BancShares  BankShares  bankShares  BankShares Bancorporation bancorporation Bancorporation Banks banks Banks Bank bank Bank   B keySym_ne     intlSym_company_neIntl intl Intl  International  international  International National national National Wordwide  worldwide  Worldwide  Southwest  southwest  Southwest  Northwest  northwest  Northwest  Southeast  southeast  Southeast  Northeast  northeast  Northeast Eastern eastern Eastern Southern western Western Northern northern Northern Southern southern Southern  Continental  continental  Continental      INWSEC pressSym_neSun sun Sun Echo echo Echo News news News Post post Post Star star Star Press press Press Times times Times Globe globe Globe Herald herald Herald Courier courier Courier Gazette gazette Gazette Tribune tribune Tribune Guardian guardian Guardian Examiner examiner Examiner Telegram telegram Telegram  Chronicle  chronicle  Chronicle  Telegraph  telegraph  telegraph  Intelligencer  Intelligencer  intelligencer  Southwest  southwest  Southwest  Northwest  northwest  Northwest  Continental  continental  Continental    SENPTGHCIcoSym_neSA sa Sa Plc plc Plc Verlag verlag Verlag Inc. Inc  Incorporated  incorporated Ltd. Ltd Limited limited Ld. Ld ld LLP LLP llp PLC PLC plc Cos Cos cos Corp. Corp  corporation  Corporation Bros. Bros bros brothers Group group Group Company company Company      SPVILCBG companySym_neEbay ebay Ebay   E comSym_neCom com Com Net net Net   CN airSym_neAir air Air Lines lines Lines Airways airways Airways Airlines airlines Airlines   AL " address_neM   ;  ;     YWNSLECHAFPDRVMGIKOTUB ,0123456789 location_address_ne;P;YWNSLECHAFPDRVMGIKOTUB ,apt_ne  AS* street_neO   NS -YWLECHAFPDRVMGIKOTUBzZotfsenh123456789*street_nospace_neO   NS -YWLECHAFPDRVMGIKOTUBzZotfsenh123456789city_address_ne;,YWNSLECHAFPDRVMGIKOTU state_address_ne;ACDFGHIKLMNOPRSTUVWEstate_address_nospace_ne;ACDFGHIKLMNOPRSTUVWEregion_address_ne;U,GCESHBAVMRNWL DKPTFIOregion_address_nospace_ne;U,GCESHBAVMRNWL DKPTFIO zip_neP1234567890  digits_ne0123456789  ordinal_ne!-zZoOtTfFsSeEnNhH123456789  hashSym_ne #\number-sign  #   cardptSym_neNE  northeast NW  northwest SE  southeast SW  southwest   NS cardptSym_nospace_neNE  northeast NW  northwest SE  southeast SW  southwest NS aptSym_neApt.  apartment Suite suite   AS rdSym_neBv.  boulevard Cr. crescent Ave avenue Pky parkway Hwy highway Way way Cir circle Sq. square St. street Ct. court Dr. drive Pl. place Rte route Pk. park Rd. road La. lane    BCAPHWSDRL rdSym_nospace_neBv.  boulevard Cr. crescent Ave avenue Pky parkway Hwy highway Way way Cir circle Sq. square St. street Ct. court Dr. drive Pl. place Rte route Pk. park Rd. road La. lane  BCAPHWSDRL cont_neNSEWLCAMOcty_neYWNSLECHAFPDRVMGIKOTU stte_neACDFGHIKLMNOPRSTUVWEregn_neUGCESHBAVMRNWL DKPTFIOloc_neYWNSLECHAFPDRVMGIKOTUB top_organization_neO0 DCcBMOLFASNWIUEHGKPRTVYorganization_neDCcBMOLFASNWIEUH GKPRTVYorganization1_ne@7(6  ( 6  &  ) '  ) % /         DCcBMOLFASNWIEUH organization2_ne * /FNAWICDGHKLMOPRSTUVEYB  university_neFNAWICUHE DGKLMOPRSTVYB university1_ne16 161/  FNAWICUHE university2_ne /FNAWICDGHKLMOPRSTUVEYB org_ne()*/*(DCcBMOLFASGHNWI known_org_ne,"#4!$3WEUCFN initcap_org_neOO5O/"# 4 ! $ 3    NWHEFAIU location_org_neACDFGHIKLMNOPRSTUVWEYB ! nationsSym_neNations nations Nations   N" whiteSym_neWhite white White   W# houseSym_neHouse house House   H$europeanSym_neEuropean european European   E% forSym_nefor for   fF& theSym_nethe the   tT'onSym_neon on   oO( orgSym_neDept Dept  Department  department Court Court court corps Corps corps Bureau Bureau bureau Musuem Musuem musuem Office Office office League League league   DCcBMOL)  org1Sym_ne Fundation  fundation  Fundation Agency agency Agency Center center Center Council council Council Society society Society Ministry ministry Ministry  Committee  committee  Committee  Commission  commission  Commission  Association  association  Association Administration administration Administration      FACSM*  org2Sym_neBoard board Board Force force Force Guard guard Guard Fleet fleet Fleet Service service Service Command command Command Squadron squadron Squadron Hospital hospital Hospital  Authority  authority  Authority     BFGSCHA+known_orgSym_all-.ECFNUASP,known_orgSym_partial-ECFNU-known_orgSym_neEU EU CIA CIA FAA FAA FBI FBI NTSB NTSB UN UN NATO NATO   ECFNU.known_orgSym_aneArmy army Army Navy navy Navy Senate senate Senate Congress congress Congress Pentagon pentagon Pentagon   ANSCP/ intlSym_neFederal federal Federal National national National American american American Wordwide wordwide Wordwide  International  international  International   FNAWI0titlSym_org_ne Secretary  secretary  Secretary  Spokesman  spokesman  Spokesman   S1 univSym_neCollege college College  Insititue  insititue  Insititue  University  university  University   CIU2 NameEntitiesp3 unionSym_neUnion union Union   U4 unitedSym_neUnited united United   U5 andSym_neand and And   aA6ofSym_neof of Of   oO7sSym_nes S.   sS8sSym_nospace_nes S. sS9 ampSym_ne&  &\AMPERSAND  ampersand and &: periodSym_ne. .\PERIOD .\DOT period .; commaSym_ne,  ,\COMMA comma ,<semicolonSym_ne:  :\SEMICOLON  semicolon := aposSym_ne' '\APOSTROPHE-SIGN  apostropy '> hyphenSym_ne- -\HYPHEN hyphen -? quotesSym_ne" "\QUOTES quotes "@ quoteSym_ne' '\QUOTE 'A ctySym_allQS BctySym_all_nospaceRTCctySym_partialQ DctySym_partial_nospaceRE geoSym_allWX ACEMODFGHIKLNPRSTUVWFgeoSym_partialW ACEMODFGHIKLNPRSTUVWGgeoSym_nospace_allYZACEMODFGHIKLNPRSTUVWHgeoSym_nospace_partialYACEMODFGHIKLNPRSTUVWI fnmeSym_all[\ JfnmeSym_partial[ K dnmeSym_all_` ACDFGHIKLMNOPRSTUVWJLdnmeSym_partial_ ACDFGHIKLMNOPRSTUVWJM nmeSym_all]^ NnmeSym_partial] O initcapSym_ne     PinitcapSym_nospace_ne  Q ctySym_ne     RctySym_nospace_ne  S ctySym_ane     TctySym_nospace_ane  U regionSym_ne     VregionSym_nospace_ne  W geoSym_ne    n    l ACEMODFGHIKLNPRSTUVWX geoSym_ane    n    l ACEMODFGHIKLNPRSTUVWYgeoSym_nospace_ne  o  mACEMODFGHIKLNPRSTUVWZgeoSym_nospace_ane  o  mACEMODFGHIKLNPRSTUVW[ fnmeSym_ne     \ fnmeSym_ane     ] nmeSym_ne     ^ nmeSym_ane     _ dnmeSym_ne    n~ ACDFGHIKLMNOPRSTUVWJ` dnmeSym_ane    n~ ACDFGHIKLMNOPRSTUVWJa titlSym_ned b   DMRb titlAbrv_neDr. doctor Mr. mister Mrs. missus Ms. miz Rev. reverend DMRc dollars-below-100.00 dollarsdollar 1234567890d dollars-plaindollarsdollar 10-.23456789e dollars-and-cents0 zero nodollarsdollar . and 0 centscent 0123456789f dollars-point0 zero oh0 ,dollar dollars0.123456789g euros-below-100.00 euroseuro 1234567890h euros-plaineuroseuro 10-.23456789i euros-and-cents0 zero noeuroseuro . and 0 centscent 0123456789j euros-point0 zero oh0 ,euro euros0.123456789k poundssterling-below-100.00 pounds sterlingpound sterling 1234567890l poundssterling-plainpounds sterlingpound sterling 10-.23456789m poundssterling-and-pence0 zero nopounds sterlingpound sterling . and 0 pencepenny 0123456789n poundssterling-point0 zero oh0 ,pounds sterlingpound sterling 0.123456789o yen-below-100yenyen sign .00 1234567890p yen-plainyenyen sign 10-.23456789q yen-pointyenyen sign 0 zero oh0 ,0.123456789r#money dollar dollar  dollars dollars $ cdf e    euro euro  euros euros   ghji    pound sterling pound sterling   pounds sterling pounds sterling     k l n m    o!p"q            !"$ -s date-era-headA.D. ADA. D. anno Domini A.H. AHA. H. anno Hebraico  anno Hegirae  anno Domini anno Domini  anno Hebraico anno Hebraico  anno Hegirae anno Hegirae At date-era-tailA.D. ADA. D. anno Domini A.H. AHA. H. anno Hebraico  anno Hegirae A.U.C. AUCA. U. C.ab urbe condita B.C. BCB. C. before Christ B.C.E. BCEB. C. E.before the common era B.P. BPB. P.before the present C.E. CEC. E.of the common era  anno Domini anno Domini  anno Hebraico anno Hebraico  anno Hegirae anno Hegirae ab urbe conditaab urbe condita  before Christ before Christ before the common erabefore the common era before the presentbefore the present of the common eraof the common era  ABCu date-month-abbrevJanuaryJan. JanJanuary FebruaryFeb. FebFebruary MarchMar. MarMarch marchAprilApr. AprApril MayMay mayJuneJun. JunJune JulyJul. July AugustAug. AugAugust  SeptemberSept. Sep. Sept September OctoberOct. O OctOctober NovemberNovNov. November DecemberDec. DecDecember  JFMASONDvdate-day-abbrevMondayMonMon. Monday TuesdayTuesTues. Tuesday  WednesdayWedWed.  Wednesday ThursdayThursThurs. Thursday FridayFriFri. Friday SaturdaySatSat. Saturday SundaySunSun. Sunday MTWFSw"date-calendar-day-ordinal-over-ten1 :20  twentieth 2 twenty 930  thirtieth 31  thirty first 123x %date-calendar-day-ordinal-with-suffix1 20th  twentieth 2 twenty 30th  thirtieth 31st  thirty first 123456789y#date-calendar-day-cardinal-over-ten1 2 twenty 0 30 thirty 31  thirty one 123zdate-calendar-day-two-digit0 9yw0123{ date-calendar-day-flex-digit9z0123456789| date-year-4-digit1234567890} date-year-2-digit''1234567890~ date-year-2-digit-noapos1234567890 date-year-either-digit}|'1234567890 date-year-either-digit-noapos~|1234567890date-year-monthd  udate-month-yearu,  ,\commad  date-month-day-year2u  {,   ,\commad date-day-month-yearthe  thex of  of{   of  of   u , ,\commad ,            date-month-the-dayu   the {,   ,\commad date-with-dayv,   ,\commad date-month-slash1 one 01 oh one 2 two 02 oh two 3 three 03 oh three 4 four 04 oh four 5 five 05 oh five 6 six 06 oh six 7 seven 07 oh seven 8 eight 08 oh eight 9 nine 09 oh nine 10 ten 11 eleven 12 twelve  1023456789' date-day-slash1 one 01 oh one 2 two 02 oh two 3 three 03 oh three 4 four 04 oh four 5 five 05 oh five 6 six 06 oh six 7 seven 07 oh seven 8 eight 08 oh eight 9 nine 09 oh nine 10 ten 11 eleven 13 thirteen 14 fourteen 15 fifteen 16 sixteen 17  seventeen 18 eighteen 19 nineteen 20 twenty 21  twenty one 22  twenty two 23  twenty three 24  twenty four 25  twenty five !26  twenty six "27  twenty seven #28  twenty eight $29  twenty nine %30 thirty &31  thirty one '  !"#$%&1023456789 date-slash/ slash ~|/ slash / slash ~ |  / slash   / slash   / slash  ~ |  / slash          1023456789decades0 thousand tTfFsSeEnN123456789 decades-plainwordstens tens twenties twenties thirties thirties forties forties fifties fifties sixties sixties  seventies  seventies eighties eighties nineties nineties tTfFsSeEnN decades-numerald10s tens 20s twenties 30s thirties 40s forties 50s fifties 60s sixties 70s  seventies 80s eighties 90s nineties   123456789 centuries00s hundreds 123456789 date  t  s          1023456789tTfFsSeEnNtime-day-special-casesnoon12:00 noon midnight12:0000:00 24:00 midnight 12:00  twelve twelve o'clock PM noon AM midnight nN1mM02 time-day-hour-12hr1 one 2 two 3 three 4 four 5 five 6 six 7 seven 8 eight 9 nine 10 ten 11 eleven 12 twelve  123456789 time-day-hour-12hr-passthroughddone one two two three three four four five five six six seven seven eight eight nine nine ten ten eleven eleven twelve twelve   oOtTfFsSeEnN time-day-minutes1 2 twenty 3 thirty 4 forty 5 fifty 0   123450 time-day-minutes-no-zero0 1 2 twenty 3 thirty 4 forty 5 fifty 0   012345 time-day-am-pm AM AMA. M.  PM PMP. M.  AM inthe morning  PM in the  afternoon evening at night      time-just-hour-12hrat  at :00 :00  at  at   :00      123456789 time-of-day-12hrat  at : 00 o'clock   hr-afterpast after  hr-beforeuntilto tiltillof time-of-day-12hr-after-TN var Network = {}; Network.cAlt = $.Parsed.cAlt; var rgAltOut = {}; for(var iAlt = 0; iAlt < $.Parsed.cAlt; iAlt++) { var AltIn = $.Parsed.rgAlt[iAlt]; var rgTokenIn = AltIn.rgToken; var rgTokenOut = {}; var AltOut = {}; var cToken = 0; for(var iToken = 0; iToken < AltIn.cToken; iToken++) { var TokenIn = rgTokenIn[iToken]; var TokenOut = {}; if (TokenIn.RuleName == "time-day-minutes") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[0] = TokenOut; cToken++; } if (TokenIn.RuleName == "hr-after") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[1] = TokenOut; cToken++; } if (TokenIn.RuleName == "time-day-hour-12hr") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[2] = TokenOut; cToken++; } if (TokenIn.RuleName == "time-day-am-pm") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[3] = TokenOut; cToken++; } } AltOut.cToken = cToken; AltOut.rgToken = rgTokenOut; rgAltOut[iAlt] = AltOut; } Network.rgAlt = rgAltOut; $.Network = Network;  : 123456789 time-of-day-12hr-before-TN function MinutesBefore(StrMinu) { var ReMinu = {}; var Str = {}; var Digit = ["one", "two", "three", "four", "five", "six", "seven", "eight", "nine"]; var Teen = ["ten", "eleven", "twelve", "thirteen", "fourteen", "fifteen", "sixteen", "seventeen", "eighteen", "nineteen"]; var Ties = ["twenty", "thirty", "forty", "fifty", "sixty", "seventy", "eighty", "ninety"]; var intMinu = parseInt(StrMinu); intMinu = 60-intMinu; if (intMinu>=1 && intMinu<=9) { ReMinu.cword = 1; Str[0] = Digit[intMinu-1]; } else if (intMinu>=10 && intMinu<=19) { ReMinu.cword = 1; Str[0] = Teen[intMinu-10]; } else if (intMinu>=20 && intMinu<=60) { var OutMinu = parseInt(intMinu); var r = new RegExp("^([0-9])([0-9])$", "ig"); var a = r.exec(OutMinu); var d1 = parseInt(RegExp.$1); var d2 = parseInt(RegExp.$2); var Str = {}; if (d2>0) { ReMinu.cword = 2; Str[0] = Ties[d1-2]; Str[1] = Digit[d2-1]; } else { ReMinu.cword = 1; Str[0] = Ties[d1-2]; } } else { ReMinu.cword = 1; Str[0] = parseInt(intMinu); } ReMinu.Str = Str; return ReMinu; } function HourBefore(StrHour) { var intHour = parseInt(StrHour); intHour = intHour+1; if (intHour > 12) { intHour = 1; } var HourTbl = ["one", "two", "three", "four", "five", "six", "seven", "eight", "nine", "ten", "eleven", "twelve"]; if (intHour>=1 && intHour<=12) { return HourTbl[intHour-1]; } else { // Error handling return intHour.toString(10); } } var Network = {}; Network.cAlt = $.Parsed.cAlt; var rgAltOut = {}; for(var iAlt = 0; iAlt < $.Parsed.cAlt; iAlt++) { var AltIn = $.Parsed.rgAlt[iAlt]; var rgTokenIn = AltIn.rgToken; var rgTokenOut = {}; var AltOut = {}; var cToken = 0; for(var iToken = 0; iToken < AltIn.cToken; iToken++) { var TokenIn = rgTokenIn[iToken]; if (TokenIn.RuleName == "time-day-minutes") { var MinVar = MinutesBefore(TokenIn.StrIn); for(var i=0; i<MinVar.cword; i++) { var TokenOut = {}; TokenOut.OutStr = MinVar.Str[i]; rgTokenOut[cToken++] = TokenOut; } } } for(var iToken = 0; iToken < AltIn.cToken; iToken++) { var TokenIn = rgTokenIn[iToken]; var TokenOut = {}; if (TokenIn.RuleName == "hr-before") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[cToken++] = TokenOut; } } for(var iToken = 0; iToken < AltIn.cToken; iToken++) { var TokenIn = rgTokenIn[iToken]; var TokenOut = {}; if (TokenIn.RuleName == "time-day-hour-12hr") { TokenOut.OutStr = HourBefore(TokenIn.StrIn); rgTokenOut[cToken++] = TokenOut; } } for(var iToken = 0; iToken < AltIn.cToken; iToken++) { var TokenIn = rgTokenIn[iToken]; var TokenOut = {}; if (TokenIn.RuleName == "time-day-am-pm") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[cToken++] = TokenOut; } } AltOut.cToken = cToken; AltOut.rgToken = rgTokenOut; rgAltOut[iAlt] = AltOut; } Network.rgAlt = rgAltOut; $.Network = Network;  : 123456789time-of-day-12hr-after-ITN var Network = {}; Network.cAlt = $.Parsed.cAlt; var rgAltOut = {}; for(var iAlt = 0; iAlt < $.Parsed.cAlt; iAlt++) { var AltIn = $.Parsed.rgAlt[iAlt]; var rgTokenIn = AltIn.rgToken; var rgTokenOut = {}; var AltOut = {}; var cToken = 0; for(var iToken = 0; iToken < AltIn.cToken; iToken++) { var TokenIn = rgTokenIn[iToken]; var TokenOut = {}; if (TokenIn.RuleName == "time-day-hour-12hr") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[0] = TokenOut; cToken++; } if (TokenIn.RuleName == "hr-after") { TokenOut.OutStr = ":"; rgTokenOut[1] = TokenOut; cToken++; } if (TokenIn.RuleName == "time-day-minutes") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[2] = TokenOut; cToken++; } if (TokenIn.RuleName == "time-day-am-pm") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[3] = TokenOut; cToken++; } } AltOut.cToken = cToken; AltOut.rgToken = rgTokenOut; rgAltOut[iAlt] = AltOut; } Network.rgAlt = rgAltOut; $.Network = Network; time-of-day-12hr-before-ITN function MinutesBefore(StrMinu) { var Digit = ["one", "two", "three", "four", "five", "six", "seven", "eight", "nine"]; var Teen = ["ten", "eleven", "twelve", "thirteen", "fourteen", "fifteen", "sixteen", "seventeen", "eighteen", "nineteen"]; var Ties = ["twenty", "thirty", "forty", "fifty", "sixty", "seventy", "eighty", "ninety"]; var r = new RegExp("^([a-zA-Z]+)[ ]*([a-zA-Z]*)$", "ig"); var a = r.exec(StrMinu); var IntMinu = 0; if (RegExp.$1 != "") { var fFound = 0; for (var i=0; i<Digit.length && !fFound; i++) { if (RegExp.$1 == Digit[i]) { IntMinu = i+1; fFound = 1; } } for (var i=0; i<Teen.length && !fFound; i++) { if (RegExp.$1 == Teen[i]) { IntMinu = i+10; fFound = 1; } } for (var i=0; i<Ties.length && !fFound; i++) { if (RegExp.$1 == Ties[i]) { IntMinu = (i+2)*10; fFound = 1; } } if (RegExp.$2 != "") { for (var i=0; i<Digit.length; i++) { if (RegExp.$2 == Digit[i]) { IntMinu += (i+1); } } } IntMinu = 60-IntMinu; return IntMinu.toString(10); } else { //error handeling return StrMinu; } } function HourBefore(StrHour) { var IntHr = -1; var HourTbl = ["one", "two", "three", "four", "five", "six", "seven", "eight", "nine", "ten", "eleven", "twelve"]; for (var i=0; i<12; i++) { if (StrHour == HourTbl[i]) { IntHr = i+1; break; } } if (IntHr>0) { IntHr -= 1; return IntHr.toString(10); } else { return StrHour; } } var Network = {}; Network.cAlt = $.Parsed.cAlt; var rgAltOut = {}; for(var iAlt = 0; iAlt < $.Parsed.cAlt; iAlt++) { var AltIn = $.Parsed.rgAlt[iAlt]; var rgTokenIn = AltIn.rgToken; var rgTokenOut = {}; var AltOut = {}; var cToken = 0; for(var iToken = 0; iToken < AltIn.cToken; iToken++) { var TokenIn = rgTokenIn[iToken]; var TokenOut = {}; if (TokenIn.RuleName == "time-day-hour-12hr") { TokenOut.OutStr = HourBefore(TokenIn.StrIn); rgTokenOut[0] = TokenOut; cToken++; } if (TokenIn.RuleName == "hr-before") { TokenOut.OutStr = ":"; rgTokenOut[1] = TokenOut; cToken++; } if (TokenIn.RuleName == "time-day-minutes") { TokenOut.OutStr = MinutesBefore(TokenIn.StrIn); rgTokenOut[2] = TokenOut; cToken++; } if (TokenIn.RuleName == "time-day-am-pm") { TokenOut.Latt = TokenIn.Latt; rgTokenOut[3] = TokenOut; cToken++; } } AltOut.cToken = cToken; AltOut.rgToken = rgTokenOut; rgAltOut[iAlt] = AltOut; } Network.rgAlt = rgAltOut; $.Network = Network;  time-of-day-quarter-pastquarter past afterto1:15 one 2:15 two 3:15 three 4:15 four 5:15 five 6:15 six 7:15 seven 8:15 eight 9:15 nine 10:15 ten 11:15 eleven 12:15 twelve   123456789 time-of-day-half-pasthalf past after1:30 one 2:30 two 3:30 three 4:30 four 5:30 five 6:30 six 7:30 seven 8:30 eight 9:30 nine 10:30 ten 11:30 eleven 12:30 twelve   123456789 time-of-day-quarter-toquarter to tiltilluntil12:45 one 1:45 two 2:45 three 3:45 four 4:45 five 5:45 six 6:45 seven 7:45 eight 8:45 nine 9:45 ten 10:45 eleven 11:45 twelve   123456789 time-of-day-phrase-twelvequarter past after 12:15 AM midnight 12:15 PM noon half past after 12:30 AM midnight 12:30 PM noon quarter to til till until 11:45 PM midnight 11:45 AM noon   1 time-of-day-special-phrasesa123456789 time-of-daynN1mM023456789time-stopwatch-separator: : time-stopwatch-hour1 one anhour hours 1023456789 time-stopwatch-minute01 one aminute minutes minute 0123456789 time-stopwatch-second01 one asecond seconds second0123456789 time-stopwatch-hms1023456789 time-stopwatch-hm:00 zero no second seconds 1023456789 time-stopwatch-hs:00 zero no minute minutes 1023456789 time-stopwatch-ms00 zero no hour hours 0 time-stopwatch1023456789capitalized-letter-TopLevel-TNABCDEFGHIJKLMNOPQRSTUVWXYZcapitalized-letterA A.AB B.C C.D D.E E.F F.G G.H H.I I.I J J. K K. L L. M M. N N.O O.P P.Q Q.R R.S S.T T.U U.V V.W W.X X.Y Y.Z Z. ABCDEFGHIJKLMNOPQRSTUVWXYZcapitalized-letter-loopABCDEFGHIJKLMNOPQRSTUVWXYZ4capitalized-letter-to-lowercasea A. b B. c C. d D. e E. f F. g G. h H. i I. j J. k K. l L. m M. n N. o O. p P. q Q. r R. s S. t T. u U. v V. w W. x X. y Y. z Z.  aAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ4$capitalized-letter-to-lowercase-loopaAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZacronyms symbol-sequence-numeric-cases        1023456789- symbol-sequence-alpha-block-unitABCDEFGHIJKLMNOPQRSTUVWXYZsymbol-sequence-alpha-block  ABCDEFGHIJKLMNOPQRSTUVWXYZ  symbol-sequence-repeat- -\hyphen-\dash . .\dot / /\slash \  \\backslash : :\colon        1023456789-%symbol-sequenceABCDEFGHIJKLMNOPQRSTUVWXYZ1023456789-  abbreviationso'clock o'clock doctor Dr.doctor mister Mr.mister missus Mrs.missus Ms.miz Ph.D. P. H. D.  professorProf.  professor attorney Atty.attorney reverend Rev.reverend versus vs.versus numberno. number  oOdDmMPpaArRvVnNabbreviations-topleveloOdDmMPpaArRvVnNwFpunctuation-single-char& _!"'(),- . / \ : ;?[]`{|} --  \em-dash \double-dash     \em-dash  \double-dash     \en-dash  \umlaut-sign  \umlaut-sign  \cent-sign   \cent-sign! \pound-sterling \pound-sign " \pound-sterling#  \yen-sign$  \yen-sign% \trademark-sign&"! "!\trademark-sign' \copyright-sign( \copyright-sign) \register-sign* \register-sign+  \dagger-sign,   \dagger-sign- \double-dagger-sign.!  ! \double-dagger-sign/ \paragraph-sign0 \paragraph-sign1 \section-sign2 \section-sign3  \sections4  \euro-sign5   \euro-sign6 \quarter-sign7 \quarter-sign8  \half-sign9  \half-sign: \three-quarters-sign; \three-quarters-sign< \multiplication-sign= \multiplication-sign> \division-sign? \division-sign@ \plus-or-minus-signA \plus-or-minus-signB  \degree-signC  \degree-signD! !\exclamation-point !\exclamation-markE"  "\open-double-quotes  "\open-quotes "\close-double-quotes "\close-quotes F#  #\pound-sign #\number-sign #\sharp  #\hash-sign G$  $\dollar-sign H%  %\percent I&  &\ampersand J'  '\open-single-quote '\close-single-quote K's 's\apostrophes-sign L(  (\open-paren (\open-parenthesisM)  )\close-paren )\close-parenthesisN*  *\asterisk O+ +\plus P,,  ,\comma Q- -\hyphen-\dash R. .\dot .\period.\point  .\decimal S. T/ /\slash U// //\double-slash V\  \\backslash W: :\colon X;  ;\semi-colon Y<  <\less-than Z= =\equals [> >\greater-than \? ?\question-mark ]@  @\at-sign ^[ [\open-bracket [\open-square-bracket_] ]\close-bracket ]\close-square-bracket`^ ^\caret a_  _\underscore b`  `\back-quote c{  {\open-brace {\open-curly-bracketd| |\vertical-bar e}  }\close-brace }\close-curly-bracketf~  ~\tilde-sign g  \not-sign \logical-not-signh \open-angle-quotes i \close-angle-quotes j9  9 \open-angle-bracket k:  : \close-angle-bracket l&   & \ellipsis & \dot-dot-dot m \function-sign n"  " \bullet-point o  TAB p;-( ;-(\wink-emoticon q:-( :-(\sad-emoticon r:-) :-)\smiley-emoticon s \registered-trademark-sign t' '\apostrophe-sign u-  -\minus-sign v&  &\and-sign w  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuv& _!"'(),-./\:;?[]`{|}   "! !  #$%& *+<=>@^~9 : "  special_rule_for_quotes''\open-single-quoteds''\close-single-quoted""\open-double-quotesds""\close-double-quotesd" "\open-quotesds ""\close-quotesd '"carriage-return-newlineNEW-LINE  carriage-return-block     H punctuation-- --\double-dash & ...  & \ellipsis -& ._!"'(),/\:;?[]`{|}   "! !  #$%& *+<=>@^~9 : " Hpunctuation-toplevel-& ._!"'(),/\:;?[]`{|}   "! !  #$%& *+<=>@^~9 : "  optional-andandoptional-space  negative- negativeminus -optional-negative-one-for-a-normal1 aan one-for-a-1  a negativea minus cardinal-zero0 zerooh 0cardinal-preserve-wordszero zero oh oh one one two two three three four four five five six six seven seven eight eight nine nine zeroth zeroth first first second second third third fourth fourth fifth fifth sixth sixth seventh seventh eighth eighth ninth ninth hundred hundred  zZoOtTfFsSeEnNhH cardinal-digit1 one2 two3 three4 four5 five6 six7 seven8 eight9 nine 123456789 cardinal-digit-plural-cases0 zero 2 two 3 three 4 four 5 five 6 six 7 seven 8 eight 9 nine 023456789 cardinal-teens0 ten 1 eleven 2 twelve 3 thirteen 4 fourteen 5 fifteen 6 sixteen 7  seventeen 8 eighteen 9 nineteen  0123456789 cardinal-tens2 twenty 3 thirty 4 forty 5 fifty 6 sixty 7 seventy 8 eighty 9 ninety 23456789!cardinal-two-digit-number-over-200 23456789 cardinal-two-digit-number1 123456789 (cardinal-two-digit-number-over-20-hyphentwenty- twenty thirty- thirty forty- forty fifty- fifty sixty- sixty seventy- seventy eighty- eighty ninty- ninety one one two two three three four four five five six six seven seven eight eight nine nine  tTfFsSeEnNcardinal-tens-below-sixty2 twenty 3 thirty 4 forty 5 fifty 2345 cardinal-numbers-below-sixty1 0 1234506789 %cardinal-numbers-below-sixty-twodigit0 1 0 0123456789  cardinal-three-digit-number1 hundred 0 0   123456789 cardinal-triple-head1 123456789 cardinal-triple-body0 0 0123456789 cardinal-nocomma-ones123456789 cardinal-nocomma-ones-tail000 0123456789 "cardinal-nocomma-four-digit-number1 thousand hundred 00   0       123456789 cardinal-nocomma-thousandsthousand 123456789 cardinal-nocomma-thousands-tail000 thousand 0123456789 cardinal-nocomma-millionsmillion 123456789 cardinal-nocomma-millions-tail000 million 0123456789 cardinal-nocomma-billionsbillion 123456789 cardinal-nocomma123456789 cardinal-comma-thousands, thousand 123456789 cardinal-comma-thousands-tail000, , thousand 0123456789 cardinal-comma-millions, million 123456789 cardinal-comma-millions-tail000, , million 0123456789 cardinal-comma-billions, billion 123456789 cardinal-comma-billions-tail000, , billion 0123456789 cardinal-comma-trillions, trillion 123456789 cardinal-comma123456789 cardinal-sequence-digit-zero0123456789 cardinal-sequence-double-digitdouble 00 zerooh 11 one 22 two 33 three 44 four 55 five 66 six 77 seven 88 eight 99 nine 1010 ten 2020 twenty 3030 thirty 4040 forty 5050 fifty 6060 sixty 7070 seventy 8080 eighty 9090 ninety  0123456789 cardinal-sequence-two-digits1234567890cardinal-sequence-zero-endd00 hundred 000 thousand 000000 million   cardinal-sequence-body-no-charshundred 00 and  0    1234567890 cardinal-sequence-body21234567890. cardinal-sequence-nodecimal-body21234567890 cardinal-sequence-cases0123456789 !cardinal-sequence-nodecimal-cases0123456789 cardinal-sequence0123456789 cardinal-sequence-nodecimal0123456789 cardinal-sequence-toplevel-0123456789 cardinal-sequence-export-loop1234567890. cardinal-sequence-exportd1234567890. cardinal-precomma-cases123456789 cardinal-standard123456789 cardinal-standard-plural0234567891 "cardinal-standard-plural-two-digit0 0123456789 cardinal-numbers-123456789 decimal-word. pointdecimaldot. decimal-cases0123456789 decimal-body. decimal-begin0 0. decimal-contain0 zero 0123456789 decimals-positive0.123456789 decimals22$-0.123456789 decimals-slimmed-down0 0123456789 decimals-positive-export0123456789 decimals-export-0123456789 cardinal-bignumber-wordout-words thousandthousand  millionmillion  billionbillion  trilliontrillion  thousandth thousandth  millionth millionth  billionth billionth  trillionth trillionth   &candinal-bignumber-and-a-half-wordouts.5  and a half 123456789 )candinal-bignumber-and-a-quarter-wordouts.25  and a quarter 123456789cardinal-bignumber-wordouts1  0.5 half a a half10 zero-cardinal-bignumber-wordoutszerozero  million million  billion billion  trillion trillion  #under10-cardinal-bignumber-wordoutsone1one two2two three3three four4four five5five six6six seven7seven eight8eight nine9nine  million million  billion billion  trillion trillion     !cardinal-trillion-billion-million trillion trillion    billion billion     million million   cardinal-billion-million billion billion    million million  $cardinal-bignumber-wordouts-toplevel 10  cardinal-standard-and-digit0123456789  cardinal-standard-export-0123456789  cardinal-range - to  -0123456789 ordinal-zero0 zeroth 0 ordinal-digit1st first 2nd second 3rd third 4th fourth 5th fifth 6th sixth 7th seventh 8th eighth 9th ninth 123456789 ordinal-digit-preserve1st firstfirst 2nd secondsecond 3rd thirdthird 4th fourthfourth 5th fifthfifth 6th sixthsixth 7th seventhseventh 8th eightheighth 9th ninthninth 1fF2sS3tT45678eE9nN ordinal-teens0th tenth 1th eleventh 2th twelfth 3th  thirteenth 4th  fourteenth 5th  fifteenth 6th  sixteenth 7th  seventeenth 8th  eighteenth 9th  nineteenth  0123456789 ordinal-tens20th  twentieth 30th  thirtieth 40th fortieth 50th fiftieth 60th sixtieth 70th  seventieth 80th  eightieth 90th  ninetieth 23456789 ordinal-two-digit-number1 123456789 ordinal-hundreds-head1 aan123456789 ordinal-hundreds-tail0 0th  hundredth hundred hundred 0123456789 ordinal-hundreds100th  hundredth  a hundredth 123456789 ordinal-ones-tail0 0 0123456789 ordinal-nocomma-four-digit1 aanthousand 000th  thousandth 1000th  thousandth  a thousandth 123456789 ordinal-triple-head1 aan123456789 ordinal-thousands, thousand 000th  thousandth 123456789 ordinal-thousands-tail000, , thousand 0123456789 ordinal-millions, million  millionth millionth ,000,000th  millionth 123456789 ordinal-millions-tail000, , million 0123456789 ordinal-billions, billion  billionth billionth,000,000,000th  billionth 123456789 ordinal-billions-tail000, , billion 0123456789  ordinal-trillions, trillion  trillionth trillionth,000,000,000,000th  trillionth 123456789! ordinal-numbers22-,negative minus           -zZoOtTfFsSeEnNhH123456789" under10-ordinal-numbers-perserve negative  negative minus  minus nNmM1fF2sS3tT45678eE9#ordinal-numbers-toplevel!"-zZoOtTfFsSeEnNhH123456789mM$  fraction-decimal-over-decimal/ overslash / overslash -0.123456789% fraction-cardinal-over-cardinal/ overslash / overslash     -0123456789.& fraction-unit-2 1/2one ahalf half a/2 halves 1023456789' fraction-unit-41/4one aquarterfourth 0 zero 2 two 3 three /4 quartersfourths 4 four 5 five 6 six 7 seven 8 eight 9 nine /4 fourths   1023456789($fraction-units-digit-normal-singular3 third 5 fifth 6 sixth 7 seventh 8 eighth 9 ninth 356789)"fraction-units-digit-normal-plural3 thirds 5 fifths 6 sixths 7 sevenths 8 eighths 9 ninths 356789* fraction-units-normal1/ one (/ )1023456789+ fraction-units&'*1023456789, fraction-digit-plural)1 firsts 22seconds 4 fourths 124356789- fraction-teens-plural0 tenths 1  elevenths 2 twelfths 3  thirteenths 4  fourteenths 5  fifteenths 6  sixteenths 7  seventeenths 8  eighteenths 9  nineteenths  0123456789.fraction-tens-plural20  twentieths 30  thirtieths 40  fortieths 50  fiftieths 60  sixtieths 70  seventieths 80  eightieths 90  ninetieths 23456789/ fraction-two-digit-number-plural.1 -,1234567890  "fraction-three-digit-number-plural12hundred /0 hundred , 0  hundredths  1234567891  !fraction-four-digit-number-plural12000  thousandths thousand 00 /00  ,  hundred  / 0  hundred   , 0  hundredths         12345678902fraction-plural-hundreds-tail, 00 ,0 /0,3 fraction-plural-thousands12,000  thousandths thousand 21234567894fraction-plural-thousands-tail, 000 2,000  thousandths thousand 2,5 fraction-plural-millions12,000,000  millionths million 41234567896fraction-plural-millions-tail, 000 4,000,000  millionths million 4,7 fraction-plural-billions12 ,000,000,000  billionths billion 61234567898 fractions-plural/ /0135702345678919 fraction-digit-singular(1 first 2 second 4 fourth 124356789: fraction-teens-singular0 tenth 1 eleventh 2 twelfth 3  thirteenth 4  fourteenth 5  fifteenth 6  sixteenth 7  seventeenth 8  eighteenth 9  nineteenth  0123456789;fraction-tens-singular20  twentieth 30  thirtieth 40 fortieth 50 fiftieth 60 sixtieth 70  seventieth 80  eightieth 90  ninetieth 23456789< "fraction-two-digit-number-singular;1 :9123456789=  $fraction-three-digit-number-singular12hundred <0 hundred 9 0  hundredth  123456789>  #fraction-four-digit-number-singular12000  thousandth thousand =0 <00  9  hundred  < 0  hundred   9 0  hundredth         1234567890?fraction-singular-hundreds-tail, 00 90 <=,@ fractions-singular-triple-head12hundred 00 0 123456789A fraction-singular-thousands@,000  thousandth thousand ?123456789B fraction-singular-thousands-tail, 000 ?,000  thousandth thousand ?,C fraction-singular-millions@,000,000  millionth million B123456789Dfraction-singular-millions-tail, 000 B,000,000  millionth million B,E fraction-singular-billions@ ,000,000,000  billionth billion D123456789F fractions-singular1 one the 1the/ <=> A C E  1G fractions-plain%+8-0123456789.H  fractions-mixed and   Ga one  half  quarter  -0123456789Ifraction_speciald one half   one fourth  one quarter   three fourths three quarters  three quarter J fractionsHG-0123456789.K fractions-toplevelJ-0123456789.Lstate_toplevelndMM;location-stateAL Alabama AK Alaska AS American Samoa AZ Arizona AR Arkansas CA  California CO Colorado CT  Connecticut DE Delaware DCD.C. D. C. District of Columbia FL Florida FM Federated States of Micronesia GA Georgia GU Guam HI Hawaii ID Idaho IL Illinois IN Indiana IA Iowa KS Kansas KY Kentucky LA  Louisiana ME Maine MH Marshall Islands MD Maryland MA  Massachusetts MI Michigan MN  Minnesota MS  Mississippi MO Missouri MT Montana NE Nebraska NV Nevada !NH  New Hampshire "NJ  New Jersey #NM  New Mexico $NY New York %NC North Carolina &ND  North Dakota 'MP Northern Mariana Island (OH Ohio )OK Oklahoma *OR Oregon +PA  Pennsylvania ,PR  Puerto Rico -RI  Rhode Island .SC South Carolina /SD  South Dakota 0TN  Tennessee 1TX Texas 2UT Utah 3VT Vermont 4VA Virginia 5VI Virgin Islands 6WA  Washington 7Washington, DC Washington D. C.  Washington DC8WV  West Virginia 9WI  Wisconsin :WY Wyoming ;  !"#$%&'()*+,-./0123456789:ACDFGHIKLMNOPRSTUVWN location-zip-five1234567890O location-zip-four0123456789P location-zipN- -\dash -\hyphenO1234567890Qlocation-state-zipM  PR location-canadian-provincesAB Alberta BC British Columbia MB Manitoba NB  New Brunswick NL Newfoundland and Labrador  Newfoundland Labrador NS  Nova Scotia NT Northwest Territories northwest territoriesNU Nunavut ON Ontario PE Prince Edward Island PQ Quebec SK  Saskatchewan YT Yukon Yukon TerritoryYukon Territories  ABMNOPSYSlocation-canadian-postal-code  Tlocation-canadianR  SU locationsQTV phone-three-digits00 hundred1234567890W phone-four-digits00 hundred 000 thousand     00 hundred    1234567890Xphone-number-dash- -\dash -Y phone-number-plainVXW1234567890Z  phone-number-area-code1 one X area code22V( V)  X 1(234567890[ phone-numberZYx  extensionext.1(234567890\ degrees-basic  o degreesdegree -0123456789]degrees-tail-temperature  C Celsius  Centigrade  centigrade F  Fahrenheit ^ degrees-dir-minutes'  minutesminute 1234506789_ degrees-dir-seconds"    secondssecond 1234506789` degrees-dir-compass-cornersNE  northeast  north eastNW  northwest  north westSE  southeast  south eastSW  southwest  south westNNE north northeast north north eastNNW north northwest north north westENE east northeast east north eastWNW west northwest west north westSSE south southeast south south east SSW south southwest south south west ESE east southeast east south eest WSW west southwest west south west  NSEWadegrees-dir-compass`N north S south E east W west `NSEWb degrees-tail-directiond^_^_a12345NSEW06789c degreese\]b-0123456789dsix_degrees_of_separationsix degrees of separation six degrees of separatione degrees-kelvin   odegreesdegree 2  K Kelvin kelvin-0123456789fdegrees-direction-word-topaNSEWgBmetric-unit-wordsg gram gramslL liter litersm meter metersB byte bytesW watt wattsTg teragram  teragramsTl  teraliter  teralitersTm  terameter  terametersTB terabyte  terabytes TW terawatt  terawatts Gg gigagram  gigagrams Gl  gigaliter  gigaliters Gm  gigameter  gigameters GB gigabyte gig gigs  gigabytesGW gigawatt  gigawattsMg megagram  megagramsMl  megaliter  megalitersMm  megameter  megametersMB megabyte meg megs  megabytesMW megawatt  megawattskg kilogram  kilogramsK. G.kl  kiloliter  kiloliterskm  kilometer  kilometerskB KBkilobyte  kilobyteskW kilowatt  kilowattskWh  kilowatt hour kilowatt hourshg  hectogram  hectogramshl  hectoliter  hectolitershm  hectometer  hectometershB  hectobyte  hectobyteshW  hectowatt  hectowattsdag decagram  decagrams dal  decaliter  decaliters!dam  decameter  decameters"daB decabyte  decabytes#daW decawatt  decawatts$dg decigram  decigrams%dl  deciliter  deciliters&dm  decimeter  decimeters'dB decibyte  decibytes(dW deciwatt  deciwatts)cg  centigram  centigrams*cl  centiliter  centiliters+cm  centimeter  centimetersCM,cB  centibyte  centibytes-cW  centiwatt  centiwatts.mg  milligram  milligramsM. G./ml  milliliter  millilitersM. L.0mm  millimeter  millimetersM. M.1mB  millibyte  millibytes2mW  milliwatt  milliwatts3g  microgram  micrograms4l  microliter  microliters5m  micrometer  micrometers6B  microbyte  microbytes7W  microwatt  microwatts8ng nanogram  nanograms9nl  nanoliter  nanoliters:nm  nanometer  nanometers;nB nanobyte  nanobytes<nW nanowatt  nanowatts=pg picogram  picograms>pl  picoliter  picoliters?pm  picometer  picometers@pB picobyte  picobytesApW picowatt  picowattsB  !"#$%&'()*+,-./0123456789:;<=>?@AgGlLmMBWTkKhHdDcCnNpPh distance-wordsmi mi.mile milesyd yd.yard yardsft ft.foot feetin. ininchinchesmilemile milesmiles yardyard yardsyards footfoot feetfeet inchinch inchesinches  mMyYfFiIi  area-words2misq. mi mi2 square mile  square milesydsq. yd yd2 square yard  square yardsftsq. ft ft2 square foot  square feetin.sq. in. in.2in2in square inch  square inchesmm2 square meter  square meterscmcm2square centimeter square centimetersmmmm2square millimeter square millimetersdmdm2square decimeter square decimeters kmkm2square kilometer square kilometers mMsSyYfFiIcCdDkKj) volume-words-cubicmi cu. mi mi3 cubic miles cubic mile  miles cubed  mile cubed  cubic miles cubic miles  cubic mile cubic mile  miles cubed miles cubed  mile cubed mile cubed yd cu. yd yd3 cubic yards cubic yard  yards cubed  yard cubed  cubic yards cubic yards  cubic yard cubic yard  yards cubed yards cubed  yard cubed yard cubed ft cu. ft ft3 cubic feet cubic foot  feet cubed  foot cubed  cubic feet cubic feet  cubic foot cubic foot  feet cubed feet cubed  foot cubed foot cubed in. cu. in. in.3 cubic inches cubic inch  inches cubed  inch cubed  cubic inches cubic inches  cubic inch cubic inch  inches cubed inches cubed  inch cubed inch cubed mm3 cubic meters cubic meter  meters cubed  meter cubed  cubic meters  cubic meters  cubic meter  cubic meter  meters cubed  meters cubed  meter cubed  meter cubed mmmm3cubic millimeterscubic millimeter millimeters cubed millimeter cubed cubic millimeters cubic millimeters cubic millimeter cubic millimeter millimeters cubed millimeters cubed millimeter cubed millimeter cubed cccm cm3cubic centimeters cubic centimeter2centimeters cubed2centimeter cubed2cc C. C.sC. C. cubic centimeters2cubic centimeters !cubic centimeter2cubic centimeter "centimeters cubed2centimeters cubed #centimeter cubed2centimeter cubed $kmkm3cubic kilometerscubic kilometer kilometers cubed kilometer cubed %cubic kilometers cubic kilometers &cubic kilometer cubic kilometer 'kilometers cubed kilometers cubed (kilometer cubed kilometer cubed )  !"#$%&'(mMcCyYfFiIkKk volume-wordsjgal2gall.dgallon gallonsC2cup cupsTbsp.2tbsp. tablespoon  tablespoonstsp.2teaspoon  teaspoonspt2pint pintsqt2quart quartsfl. oz.2 fluid ounce  fluid ouncesgGCTtpPqQfFmMcyYiIkKl weight-words2lb. pound poundsoz. ounce ounceslLoOm speed-words2mps miles per secondmile per second miles a second  mile a second mph miles per hour mile per hour  miles an hour  mile an hour mpg miles per gallonmile per gallon miles a gallon  mile a gallon miles to the gallon mile to the gallon kpg kilometers per gallonkilometer per gallon kilometers a gallon kilometer a gallon kilometers to the gallon kilometer to the gallon kps kilometers per secondkilometer per second kilometers a second kilometer a second kphkilometers per hourkilometer per hour kilometers an hour kilometer an hour kilometers per gallon kilometers per gallon kilometer per gallon kilometer per gallon kilometers a gallon kilometers a gallon kilometer a gallon kilometer a gallon kilometers to the gallon kilometers to the gallon kilometer to the gallon kilometer to the gallon kilometers per second kilometers per second kilometer per second kilometer per second kilometers a second kilometers a second kilometer a second kilometer a second kilometers an hour kilometers an hour kilometer an hour kilometer an hour kilometers per hour kilometers per hour kilometer per hour kilometer per hour  mMkKn time-words22Hz Hertzhertz pHz  picohertz nHz  nanohertz Hz  microhertz mHz  millihertz cHz  centihertz dHz  decihertz daHz  decahertz hHz  hectohertz kHz  kilohertz MHz  megahertz GHz  gigahertz THz  terahertz ms milliseconds millisecond  milliseconds  milliseconds  millisecond  millisecond ssec. secondssecond secondsseconds secondsecond min. minutesminute minutesminutes minuteminute hr.h. hourshour hourshours hourhour  HpnmcdhkMGTsSo6measurement-wordouts  seconds seconds second second minute minute minutes minutes hour hour hours hours ton ton ton ton  metric ton  metric ton  metric tons  metric tons gallon gallon gallons gallons pound pound pounds pounds ounce ounce ounces ounces  square mile  square mile  square miles  square miles  square yard  square yard  square yards  square yards  square foot  square foot  square feet  square feet  square inch  square inch  square inches  square inches  square meter  square meter  square meters  square meters cup cup cups cups  tablespoon  tablespoon  tablespoons  tablespoons teaspoon teaspoon  teaspoons  teaspoons !pint pint "pints pints #quart quart $quarts quarts %liter liter &liters liters ' fluid ounce  fluid ounce ( fluid ounces  fluid ounces )miles per second miles per second *miles a second miles a second +miles per minute miles per minute ,miles a minute miles a minute -miles per hour miles per hour . miles an hour  miles an hour /kilometers per second kilometers per second 0kilometers a second kilometers a second 1kilometers per minute kilometers per minute 2kilometers a minute kilometers a minute 3miles per gallon miles per gallon 4miles a gallon miles a gallon 5miles to the gallon miles to the gallon 5  !"#$%&'()*+,-./012345pand-measurement-wordout-loop and and   soqmeasurement-no-spaces-words' feetfoot '\apostrophe-signd"   inchinches % percent  %\percentdc centscent  \cent-signd' " %cCr#measurement-wordsghiklmngGlLmMBWTkKhHdDcCnNpPyYfFiIsStqQoOs metric-numeric-formsJv-0.123456789tand-metric-loop  and sru and-measurement-no-spaces-loopand sq-0.123456789v Optional-of-aof a of an of the of a an w metrics to  to sr o q  u rtop   -0.123456789xwordout-negativenegative negative minus minus nNmMy wordout-under10-numberone one two two three three four four five five six six seven seven eight eight nine nine oOtTfFsSeEnNzwordout-bignumbermillion million billion billion trillion trillion  millionth  millionth  billionth  billionth  trillionth  trillionth mMbBtT{measurement-words-out-allo|under10-wordout-metricx  y  z{y    z {    a  a  an  an  z { a a  an an  { x   y  zy  za a an an   z         } metric-exceptions-with-half1 1/2 1 a  qr and a half one and a half one and one half qra  1/2  half of  a q r    1~ metric-toplevelw}|-0.123456789TNablewords-toplevelWin32 Win32 win32 win32 Win64 Win64 win64 win64 C++ C++ J++ J++ C# C# J# J# 2D 2D 3D 3D .Net .Net .NET .NET Win2K Win2K win2k win2k  WwCJ23.4hyphenwords-toplevel- - - - 's 's s' s' 'S 'S S' S' 't 't 'd 'd 'll 'll 're 're 've 've 'm 'm 's 's s' s' 'S 'S S' S' 't 't 'd 'd 'll 'll 're 're 've 've 'm 'm    abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ74worda a b b c c d d e e f f g g h h i i j j k k l l m m n n o o p p q q r r s s t t u u v v w w x x y y z z A A B B C C D D E E F F G G !H H "I I #J J $K K %L L &M M 'N N (O O )P P *Q Q +R R ,S S -T T .U U /V V 0W W 1X X 2Y Y 3Z Z 4 56  4  !"#$%&'()*+,-./0123465abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ4WebTermswWhHfFmMabcdegijklnopqrstuvxyzABCDEGIJKLNOPQRSTUVXYZ URLwww www W. W. W. . dot .\dot http http https https ftp ftp mailto mailto : :\colon / /\slash / /\slash  . dot .\dot    . dot .\dot      wWhHfFmM4EMail@  @\at-sign . dot .\dot abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ Company microsoft Microsoft Microsoft amazon Amazon amazon amazon sun Sun sun sun web Web web web hotmail Hotmail hotmail hotmail mMaAsSwWhH Organizationcom com org org O. R. G gov gov G. O. V. edu edu E. D. U. net net cCoOgGeEnN4NameabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZJH; SmallSpan_AllP t s x of of { uaSRMPoghi k!l"m#n$w%G&'()*+,-./0123456789:;<=>?@ABCDEFGzHxIyHH   FED'(% !"#$HIG-8945?.6123+)*&0/,7A=C:;<B>@ ABCJFMSOND1234567890'EGHIKLPQRTUVWXYZ-fsten.glmkhdcpyiqob"SmallSpan_date-day-month-year_sec1u,  ,\commadJFMASOND,SmallSpan_location-canadian-postal-code_sec1ABCDEFGHIJKLMNOPQRSTUVWXYZ ,SmallSpan_location-canadian-postal-code_sec20123456789 SmallSpan_fractions-mixed_sec1 and -0123456789 SmallSpan_fractions-mixed_sec2G-0123456789."SmallSpan_time-just-hour-12hr_sec1:00 123456789oOtTfFsSeEnN "SmallSpan_time-just-hour-12hr_sec2:00 123456789 "SmallSpan_date-month-day-year_sec1{,  ,\commad0123456789 !SmallSpan_fractions-singular_sec1<=>ACE1234567890SmallSpan_money_sec1dollar dollar dollars dollars dDSmallSpan_money_sec2euro euro euros euros eESmallSpan_money_sec3pound pound pounds pounds sterling sterling pPsS &SmallSpan_date-calendar-day-flex-digit  the {,  ,\commad  of of 0123456789SmallSpan_optional-andand  +SmallSpan_and-measurement-wordout-loop_sec1so-0.123456789 SmallSpan_and-metric-loop_sec1so-0.123456789#SmallSpan_preserve-wordof of C C F F in in in.  in .\period pm pm 2D two D. OK ok AB ab AL al AS as CO co DC dc FM fm HI hi ID id IN in KY ky LA la MA ma MD md ME me MO mo MP mp MS ms NB nb NE ne NL nl OH oh ON on OR or PA pa !PE pe "PR pr "  !"oOCFiIpP2ADHKLMNSmallSpan_theonethe 1 the the one tT +SmallSpan_optional-negative-fractions-plainG-0123456789. SmallSpan_degrees\]b-0123456789SmallSpan_date-month-year_sec1  of u,  ,\commadJFMASONDSmallSpan_date-day-abbrevv,  ,\commadMTWFSSmallSpan_hyphen- -\hyphen-\dash -%SmallSpan_time-day-special-cases_sec112:00 twelve twelve o'clock 1 %SmallSpan_degrees-dir-minutes-secondsd^_^_1234506789 SmallSpan_flfl fluid . fF SmallSpan_ozoz ounce ounces .oO 2SmallSpan_under10-cardinal-bignumber-wordouts_sec1one1one two2two three3three four4four five5five six6six seven7seven eight8eight nine9nine oO1tT23fF45sS67eE8nN9"SmallSpan_million-billion-trillionmillion million billion billion trillion trillion mMbBtTSmallSpan_negativenegative negative minus minus nNmM  SmallSpan_ordinal-numbers-,negative minus    -123456789%SmallSpan_time-day-special-cases_sec2PMnoon AMmidnight PA SmallSpan_time-day-am-pmAM AMA. M. PM PMP. M. AM inthe morning PM in the  afternoon evening at night   AP SmallSpan_time-of-day-12hr_sec1: 00  o'clock 123456789#(SmallSpan_measurement-words_optional_andrgGlLmMBWTkKhHdDcCnNpPyYfFiIsStqQoO"SmallSpan_degrees-tail-temperatureC Celsius  Centigrade  centigrade F  Fahrenheit CF fortune500AES aes Aetna aetna AFLAC aflac AGCO agco  Albertson's  albertson's Alcoa alcoa Allstate allstate Alltel alltel  Amazon.com  amazon.com Ameren ameren AmerisourceBergen amerisourcebergen Amgen amgen AMR amr Anheuser-Busch anheuser-busch Aramark aramark  ArvinMeritor  arvinmeritor AT&T at&t Autoliv autoliv  AutoNation  autonation AutoZone autozone Avaya avaya Avnet avnet  BellSouth  bellsouth Boeing boeing Brink's brink's  Brunswick  brunswick Calpine calpine CarMax carmax CDW cdw Cendant cendant Centex centex  ChevronTexaco  chevrontexaco !CHS chs "Cigna cigna #Cinergy cinergy $ Citigroup  citigroup %Clorox clorox &CNF cnf ' Coca-Cola  coca-cola (Colgate-Palmolive colgate-palmolive )Comcast comcast *ConocoPhillips conocophillips +Conseco conseco ,Corning corning -CSX csx .Cummins cummins /CVS cvs 0Dana dana 1Danaher danaher 2Delphi delphi 3 Dillard's  dillard's 4Dover dover 5DuPont dupont 6Dynegy dynegy 7Eaton eaton 8Ecolab ecolab 9EMC emc : Engelhard  engelhard ;Entergy entergy <Exelon exelon = Federal-Mogul  federal-mogul >FedEx fedex ? FirstEnergy  firstenergy @Fluor fluor AGannett gannett BGeorgia-Pacific georgia-pacific CGillette gillette DGoodrich goodrich EGuidant guidant F Halliburton  halliburton GHarley-Davidson harley-davidson HHewlett-Packard hewlett-packard IHumana humana JJefferson-Pilot jefferson-pilot KKellogg kellogg L Kerr-McGee  kerr-mcgee MKeyCorp keycorp NKeySpan keyspan OKimberly-Clark kimberly-clark PKohl's kohl's QKroger kroger RLennar lennar SLoews loews TLowe's lowe's UManpower manpower VMasco masco WMattel mattel XMaxtor maxtor YMaytag maytag ZMBNA mbna [ McDonald's  mcdonald's \ McGraw-Hill  mcgraw-hill ]MCI mci ^McKesson mckesson _ MeadWestvaco  meadwestvaco ` Medtronic  medtronic aMerck merck bMetLife metlife c Microsoft  microsoft dMirant mirant eMonsanto monsanto fMotorola motorola g Nationwide  nationwide hNCR ncr iNike nike jNiSource nisource k Nordstrom  nordstrom lNTL ntl mNucor nucor nNVR nvr o OfficeMax  officemax pOmnicare omnicare qONEOK oneok rOwens-Illinois owens-illinois sPaccar paccar tPepsiCo pepsico uPfizer pfizer vPPL ppl wPraxair praxair xPremcor premcor yQualcomm qualcomm z RadioShack  radioshack {Raytheon raytheon |Roundy's roundy's }Safeco safeco ~Safeway safeway Saks saks  Sanmina-SCI  sanmina-sci SCANA scana Schering-Plough schering-plough  ServiceMaster  servicemaster Sherwin-Williams sherwin-williams SLM slm  Solectron  solectron SPX spx  Starbucks  starbucks Stryker stryker Sunoco sunoco  Supervalu  supervalu Sysco sysco  Temple-Inland  temple-inland Terex terex Tesoro tesoro Textron textron  TIAA-CREF  tiaa-cref Timken timken TJX tjx TransMontaigne transmontaigne TXU txu UAL ual UGI ugi Unisys unisys Unocal unocal  UnumProvident  unumprovident USAA usaa USG usg VF vf Viacom viacom Visteon visteon  Walgreens  walgreens  WellChoice  wellchoice  Wellpoint  wellpoint  Weyerhaeuser  weyerhaeuser Williams williams Wyeth wyeth Abbott Laboratories abbott laboratories Advance Auto Parts advance auto parts Advanced Micro Devices advanced micro devices Affiliated Computer Svcs. affiliated computer svcs. Agilent Technologies agilent technologies Air Products & Chem. air products & chem. AK Steel Holding ak steel holding Allied Waste Industries allied waste industries  Altria Group  altria group  Amerada Hess  amerada hess American Electric Power american electric power American Express american express American Family Ins. Grp. american family ins. grp. American Financial Grp. american financial grp. American Intl. Group american intl. group American Standard american standard Anadarko Petroleum anadarko petroleum Apple Computer apple computer Applied Materials applied materials Archer Daniels Midland archer daniels midland Arrow Electronics arrow electronics Asbury Automotive Group asbury automotive group Automatic Data Proc. automatic data proc. Auto-Owners Insurance auto-owners insurance Avery Dennison Corporation avery dennison corporation  Avon Products  avon products  Baker Hughes  baker hughes Bank of America Corp. bank of america corp. Bank of New York Co. bank of new york co. Barnes & Noble barnes & noble Baxter International baxter international  BB&T Corp.  bb&t corp.  Bear Stearns  bear stearns Beazer Homes USA beazer homes usa Becton Dickinson becton dickinson Bed Bath & Beyond bed bath & beyond Berkshire Hathaway berkshire hathaway Best Buy best buy Big Lots big lots BJ's Wholesale Club bj's wholesale club Black & Decker black & decker  Borders Group  borders group Boston Scientific boston scientific Brinker International brinker international Bristol-Myers Squibb bristol-myers squibb Burlington No. Santa Fe burlington no. santa fe Burlington Resources burlington resources C.H. Robinson Worldwide c.h. robinson worldwide Cablevision Systems cablevision systems Caesars Entertainment caesars entertainment  Campbell Soup  campbell soup Capital One Financial capital one financial Cardinal Health cardinal health  Caremark Rx  caremark rx CenterPoint Energy centerpoint energy Charles Schwab charles schwab Charter Communications charter communications Cincinnati Financial cincinnati financial Circuit City Stores circuit city stores  Cisco Systems  cisco systems  CIT Group  cit group Clear Channel Communications clear channel communications  CMS Energy  cms energy Coca-Cola Enterprises coca-cola enterprises Collins & Aikman collins & aikman Commercial Metals commercial metals Computer Sciences computer sciences  ConAgra Foods  conagra foods Consolidated Edison consolidated edison Constellation Energy constellation energy Continental Airlines continental airlines Cooper Tire & Rubber cooper tire & rubber Costco Wholesale costco wholesale Countrywide Financial countrywide financial Coventry Health Care coventry health care Cox Communications cox communications Crown Holdings crown holdings  D.R. Horton  d.r. horton Darden Restaurants darden restaurants  Dean Foods  dean foods Deere & Company deere & company Delta Air Lines delta air lines  Devon Energy  devon energy  DIRECTV Group  directv group  Dole Food  dole food Dollar General dollar general Dominion Resources dominion resources  Dow Chemical  dow chemical  DTE Energy  dte energy  Duke Energy  duke energy Eastman Chemical eastman chemical  Eastman Kodak  eastman kodak Echostar Communications echostar communications Edison International edison international El Paso el paso Electronic Data Systems electronic data systems  Eli Lilly  eli lilly  Emcor Group  emcor group Emerson Electric emerson electric Enbridge Energy Partners enbridge energy partners  Energy East  energy east Enterprise Products enterprise products Erie Insurance Group erie insurance group  Este Lauder  este lauder Express Scripts express scripts  Exxon Mobil  exxon mobil Family Dollar Stores family dollar stores Federated Department Stores federated department stores Fidelity National Financial fidelity national financial Fifth Third Bancorp fifth third bancorp First American Corp. first american corp. First Data Corporation first data corporation Fisher Scientific Intl. fisher scientific intl.  Foot Locker  foot locker  Ford Motor  ford motor Fortune Brands fortune brands  FPL Group  fpl group General Dynamics general dynamics General Electric general electric  General Mills  general mills General Motors general motors  Genuine Parts  genuine parts Golden West Financial golden west financial !Goldman Sachs Group goldman sachs group "Goodyear Tire & Rubber goodyear tire & rubber #Graybar Electric graybar electric $Group 1 Automotive group 1 automotive %Guardian Life of America guardian life of america & H&R Block  h&r block ' H.J. Heinz  h.j. heinz (Harrah's Entertainment harrah's entertainment )Hartford Financial Services hartford financial services * Health Net  health net + Henry Schein  henry schein , Hershey Foods  hershey foods - Home Depot  home depot .Honeywell Intl. honeywell intl. / Hormel Foods  hormel foods 0Hospital Corporation of America hospital corporation of america 1 Host Marriott  host marriott 2Hovnanian Enterprises hovnanian enterprises 3 Hughes Supply  hughes supply 4Ikon Office Solutions ikon office solutions 5Illinois Tool Works illinois tool works 6 Ingram Micro  ingram micro 7International Paper international paper 8International Steel Group international steel group 9Interpublic Group interpublic group :Intl. Business Machines intl. business machines ;ITT Industries itt industries < J.C. Penney  j.c. penney =J.P. Morgan Chase & Co. j.p. morgan chase & co. > Jabil Circuit  jabil circuit ?Jacobs Engineering Grp. jacobs engineering grp. @Johnson & Johnson johnson & johnson AJohnson Controls johnson controls BJones Apparel Group jones apparel group CKB Home kb home DKelly Services kelly services EKinder-Morgan Energy kinder-morgan energy FKindred Healthcare kindred healthcare G Kmart Holding  kmart holding HL-3 Communications l-3 communications ILaidlaw International laidlaw international J Land O'Lakes  land o'lakes KLeggett & Platt leggett & platt LLehman Brothers lehman brothers MLevel 3 Communications level 3 communications N Levi Strauss  levi strauss OLexmark International lexmark international P Liberty Media  liberty media QLiberty Mutual liberty mutual RLimited Brands limited brands SLincoln National lincoln national T Liz Claiborne  liz claiborne ULockheed Martin lockheed martin VLongs Drug Stores longs drug stores WLucent Technologies lucent technologies XLyondell Chemical lyondell chemical Y Marathon Oil  marathon oil ZMarriott International marriott international [Marsh & McLennan marsh & mclennan \+Massachusetts Mutual Life Insurance Company +massachusetts mutual life insurance company ]May Dept. Stores may dept. stores ^ MDC Holdings  mdc holdings _Medco Health Solutions medco health solutions `Mellon Financial Corp. mellon financial corp. a Merrill Lynch  merrill lynch b MGM Mirage  mgm mirage cMicron Technology micron technology dMohawk Industries mohawk industries eMolson Coors Brewing molson coors brewing fMorgan Stanley morgan stanley g Murphy Oil  murphy oil hMutual of Omaha Ins. mutual of omaha ins. i Nash Finch  nash finch jNational City Corp. national city corp. kNavistar International navistar international lNew York Life Insurance new york life insurance mNewell Rubbermaid newell rubbermaid nNewmont Mining newmont mining o News Corp.  news corp. pNextel Communications nextel communications qNorfolk Southern norfolk southern rNortheast Utilities northeast utilities sNorthrop Grumman northrop grumman tNorthwest Airlines northwest airlines uNorthwestern Mutual northwestern mutual vOccidental Petroleum occidental petroleum w Office Depot  office depot x OGE Energy  oge energy y Omnicom Group  omnicom group zOracle Corporation oracle corporation { Owens & Minor  owens & minor | Owens Corning  owens corning } Pacific Life  pacific life ~PacifiCare Health Sys. pacificare health sys. Parker Hannifin parker hannifin Pathmark Stores pathmark stores Peabody Energy peabody energy Pepco Holdings pepco holdings Pepsi Bottling pepsi bottling Performance Food Group performance food group  PG&E Corp.  pg&e corp.  Phelps Dodge  phelps dodge Pilgrim's Pride pilgrim's pride  Pitney Bowes  pitney bowes Plains All Amer. Pipeline plains all amer. pipeline PNC Financial Services pnc financial services PPG Industries ppg industries Principal Financial principal financial Procter & Gamble procter & gamble Progress Energy progress energy Prudential Financial prudential financial Public Service Enterprise Group public service enterprise group Publix Super Markets publix super markets  Pulte Homes  pulte homes Quest Diagnostics quest diagnostics Qwest Communications qwest communications R.R. Donnelley & Sons r.r. donnelley & sons Reebok International reebok international Regions Financial regions financial Reliant Energy reliant energy Reynolds American reynolds american Rite Aid rite aid Rockwell Automation rockwell automation  Rohm & Haas  rohm & haas  Ross Stores  ross stores  Ryder System  ryder system  Ryland Group  ryland group Sara Lee sara lee SBC Communications sbc communications Science Applications Intl. science applications intl.  Sealed Air  sealed air  Sears Roebuck  sears roebuck  Sempra Energy  sempra energy Smith International smith international Smithfield Foods smithfield foods Smurfit-Stone Container smurfit-stone container Sonic Automotive sonic automotive Southwest Airlines southwest airlines St. Paul Travelers st. paul travelers Starwood Hotels & Rsrts. starwood hotels & rsrts. State Farm Insurance Cos state farm insurance cos State St. Corp. state st. corp. Stater Bros. Holdings stater bros. holdings Sun Microsystems sun microsystems SunTrust Banks suntrust banks  Tech Data  tech data Telephone & Data Sys. telephone & data sys. Tenet Healthcare tenet healthcare Tenneco Automotive tenneco automotive Texas Instruments texas instruments  Thrivent Financial for Lutherans  thrivent financial for lutherans  Time Warner  time warner  Toll Brothers  toll brothers  Toys `R` Us  toys `r` us Triad Hospitals triad hospitals TRW Automotive Holdings trw automotive holdings  Tyson Foods  tyson foods  U.S. Bancorp  u.s. bancorp  Union Pacific  union pacific United Auto Group united auto group United Parcel Service united parcel service United States Steel united states steel United Stationers united stationers United Technologies united technologies UnitedHealth Group unitedhealth group Universal Health Svcs. universal health svcs. US Airways Group us airways group  Valero Energy  valero energy Verizon Communications verizon communications  W.R. Berkley  w.r. berkley  W.W. Grainger  w.w. grainger Wachovia Corp. wachovia corp. Wal-Mart Stores wal-mart stores  Walt Disney  walt disney Washington Mutual washington mutual Waste Management waste management  Wells Fargo  wells fargo Wendy's International wendy's international Wesco International wesco international Western & Southern Financial western & southern financial Whole Foods Market whole foods market Winn-Dixie Stores winn-dixie stores Wisconsin Energy wisconsin energy Wm. Wrigley Jr. wm. wrigley jr. World Fuel Services world fuel services  WPS Resources  wps resources  Xcel Energy  xcel energy Yellow Roadway yellow roadway York International york international  Yum Brands  yum brands   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ mswindowsVista Starter Edition vista starter edition Vista Home Basic vista home basic Vista Home Premium vista home premium Vista Pro Standard Edition vista pro standard edition Vista Pro Standard vista pro standard Vista Small Business Edition vista small business edition Vista Pro Enterprise Edition vista pro enterprise edition Vista Ultimate Edition vista ultimate edition  Windows Vista  windows vista Microsoft Vista microsoft vista Microsoft Windows microsoft windows WinPE win pe Xbox xbox Xbox360 xbox360   tagsfilecapsFirst World War 1st World War First World War Second World War 2nd World War Second World War Attorney General Atty. General Attorney General top_location_nenACDFGHIKLMNOPRSTUVWEYB J& COMPANYKEYTRIE_HWX`#|IRERTRARRRORNRURCRLRSRPRMROFRTDRITTNAEIGRCEIRNWRRUBRKRAESHMLSCLCTVRRADSRIEHSRLRHRPUONGNNGNMGMGFOSOOOOMHFPPQRMFELHRLESLSEDDSTKDCCTTCPBAUVAVWIWXYYYYRY  /!#*57ENSTX{%'" !;   &4mV1+s Lxq   & y x  T.W ^5#G[/> ! $ Dhk4  g 0@9:>/"-CI z F`Z b#v &7  ' 8' M j* *t7$  O U;f )j-uMcQM (+vS?vE?P ), 3{ A 1 l_8;.w K nr#g q -H!!a%   P 3,Xv  6*+ owNB{ d  #6 w$p%< [ h J i< g,M"h"52=Y  Pa \90.q  ( Re P!]=:  ( )"2 / tGFCBKJHIDEkijnml-,+*()#"!$'%&vstuA<=;:98@?>rqopYZTUWXVhgfecdb{z| wxy45763210/.ROPLMNQS  []\^`a_}~jkhgitsqpronmlvwefuBCDAIGHKLJNMFE\[ZYXWSTVU'&%$"#*)(! `ab^_c]d2364501xzy{~|}=;<:987  -.,+ OPQ?>@R/k CTY_AMBIGTRIE_HWX~ k!|ERARRRIRORNRLRTRHRMRSRCRPRRBRADRFRAURORURWREIDORNTGNULLVLKRAVREYUITITISHSLHDLELPOONUMNNGNGNFNMOFEEMMOPGEPPQRRGHDRDRDSSLDKSTCCTITHCBBHGRBAWWIXYYYRAZ+ u   $'+79;<FGR4g I q  ;3tC&^ K"% ! 2 ; puNH;Q W ePaS:c'_(7(< 8Z 3x y .&!  =X|A o<]c  l#, 2  \ d4! rzV0B.h bi] $]1q F$h#/:=,m`jqY&D` 7  ]@     U 65" >daOv=)J-  ( ' k89+|6 w'La*Es ?=+) 9% [#d/)*-"*M0 $?  Gpn5 {1%R  >Tf (k821965743,.-0/)*+('&`ajcbXWVTUGFCBHEDf\[ZY! $%#"iedA;:<=>?@POSQR   _^]ghJINKLM]^_\XYWUT[ZRSV<=;:9786A@>? GFHIJKLE-,0/+*.fehijgNMPQO()'&%5432ba` !$#DC1cdB" CTY_UNAMBTRIE_HWX4(or ARERORNRIRRRLRTRSRCRHRBRRURNGRDRLEMREAITANRIKRSIOTLOASLPRSUENOUTATFRERDFOMMIVWRSGDCUBRRKHOIVRGMDSKNMMPNIYWAYOWCBEHGLFTLCHAGBVCLZRJVPGRUNBDHYRPBEYVKZANSYWWHKDZKPVKMUWJRTEDZQROHGCCJPPEXXLOJSUYYIZYBASFFZTNESVIJYFXTXRRRTSXZJMQNSUOSNNNPMMQVLKKSKQTVWIIISHHHWXGQRGTXGFSFDDCBSBZASA.R.'7{ N w [ JaB ? >IDk>E  q?> :2 Q 'H;]|V &D 4AYnO/' ?- >~`    "!=%',45O #)1:J027AILd$&(+-.89;<>?@CFGNQY[^`afilpy8rrH6n'l>mfk`jm[gWi Wh\ReCQd]CfBc=@b 5a2^,_*]g'Z\R5 &(+" ,1@* 'Y#UV( = D+S!   .  l;J$I L8Rn7hE l0#F<0 G?83 ]C% 1:y1#%08*> Y~\M+.QtD#(z $<7hG,B D  ) ok)A)k @'V* ;H:3!' OR H ?$")VF g/i)P.ej >y7<%I_T^$ =' 8P2` w'Jd2~Y -'6C ]    ^Q"#;Z i$ <) #h-9] os  ,S"+?+ 21"+d`E )ZL/&P8[Œ t؃#] ^I*qp t(,cH .)< @B)<5  x{ A HN N #G wDE&$ 'QB-&Z F8A/G3 N =$ S <0 _5 Ltj8(;`43( 3V C% gR$AM -I= '> FvcnV]8 |'r  B-eV #E[.( 4^?_!(t &") ] )j)= {Q6 ClXBU ! )m'6(n4l  GTf'- # mJ,* ;}+ 4*d LR"3 <Q[{+%H6!M  R p   l`?e7$G!!0+>o D- f^*/P4CUP.Rq 1#&%X) g6vW00y  RW;Ml@L:UO7bV!,(W/ ?{Q B;TB & /+-I-ZH} #x ,TC5s=9@'ZzO8_*_x IqvD Yp8qib9-N[!/1 &' +6: r(= C >mg ]WS D Clh"KU]EY) "QX8":@dFi{i1Qr F^9 8.Q ,o?" ~&P3a1#7)]@=HNIz.24 3ON 8EAtD@\ KT7E M %%we9wQ"a&KF 7BU )8$ ^`8 )pdSakk]K LMR$1d#2# Y& i&a5%2j5 i(L&0F >C\(VzfHN0H8)|k g17HcNf"@cI:#q*iMT^!%+ ;t5r> =U>HI*EKh0L % Z@  '[5%9: _ "+ ,_ ( 6]T?Jlh JzPE3939@'WMg/>nGMF$;J &j89- 8 +S6 g/;  >J   d< N "@N@ET^]h A kVQG 0; (7\uym ' =6 vRX*\/ 0H7I* !8{6K AV}>; ,(8 (wYo}&a}J/2   6" ;cmp iS%%[,OK 8/5Y8" & &   %(Q"axY; 52,C1wp< +(U VD >* A]4G%)2   HBx )_6  `m -G Pe - QS !dN : +^&DP5N ,\/(  ( (   C KGQRYz:OK14*a`9w2>KލR-CG:$R<v-05z! $ 5 1<uC<&D # > 3 =  " gK E=R-&U ,+7>7  @2@' _{ - '/VD :L b42O[*L.Y!0|k 2N A ZB4=; OZ+3h M$`f .U$W-J0LDP(  * %\86 $6 C"Sh\;?e F ;<$.m# F}*v ,L6U+ <Fh  (vQT{E# ?H7?q~"C:#y '  |(*,Y&!  N{ 5.<.a@6H %1v/zk RI   0&Z $ (" &!-2< !"+R?. @2e/  n OXb P ,ZLV2Z! (W >B( u,A6 ! g] ;/{SACf'J F N@/$N3  90f $. MxEV@' e ,4*.w9 l4& +L. o i@0#io~378Jymr(EYOE !kV]YC? fEnN R7Xx I 1$. )(81 M}A![!  q=o/o%b@)#& oJ  SJA( \:k6   ;|ZW Cx{D-51L.nRj+!fM^ p,PaH W3:bF DU& D" 8   ' Ie ]t9P2E ?T^!%`u  ;N. 8   ]DR LA`[ L*i2 N1r 4XBh'N&ikqpobX+!Ju#+ $NB A,= ,( C$s4+ (I00O- @%0 94 ?_5 E:fsO#q|j  ;| A9zh1?d- 4*  q s+@[h_A/SkEe ,# p "_* oK ?#oJb1 5>  'H9T"B/")Py O 2$ 8N[! ' m]Z2RcOp  ) cm"L1k3." 1& DG 9,%d E4F-@,3 g"7! 7-Y!K:E#. 4U~.!+;u$ K (s B&rI2U  VA<A3*o3-F  h%7Q $< @(, 2) Ύ  g > VTb6T OD !).A%4ZGF)cGbr  'aJ% .GM>{3 #fcjM; MAoJ-/Up 4c*: 9 5 `&9 c)/- ,YxS }&P [ ,  & * " M$' >6Qe/? MkT?U  %O*[9@'%%9_* !6\A 8  =? G$1*O@J)3>= HS!! 4%%I$43^YIlXVP eP8] &3 ( $ )</!B D1 J8 t =[7hp`P2 O;Y% _2C 2O|k# "KV\a 3 %Du r7hzP F#"SL7>H ! [#n[ #Kl* i*i2E,'$ mC 6> plXes  $ \ X%/.U$).Hx7#S 1F>U h)VP9!%! $4|Fy\qy_*R/3.(8U 0 :$c  K fc`md,1M *5 `8s ;*" ;  iBA jOG+ 9' G\n ^q T~X6q  0*}7) 005d<p D=% *3# *' >vx/T F= ]gQ/ D&5 a3 A#g -K/0#&dw  d #+P  b( &- Cp-c\ L$P%2D7LB:_G pX jDlIn3j1/j +" :b m   -&(fV H D(8qNB _`XWVY^]ecab\[ZdSPUTONMLKJQRIFEGHqsihkjngfomlrputvw}{yxz~|spomnlkjia`_\]^bY[ZUVWSTXRQdcerqghf )'"!$#  (  &%vut}z{|xyw~64321,+*-.0/5IHKJFGB@?AEDCM=<987>;:OPNL@AB     DC0/-.,4312657+('# !"*)&%$>=?<89:;LKOGEFPHJI?@=><CDBANMjkhcdabgefiwstuv{qrmlopnyx`SQTR_^UVXW[YZ]\z'*()548!" 60./-,+%&$#2137;543+*,9210('&)%$" #!67-/.:8WVUSOPTQRMNLK^ZXY[\]DBC>=<HIJGA?@FEb`_acedzy{|}~noihlkjmtpqsrwuvgcba`defx{}qrmklpnogfjhi|wxytsvuz~  6543&"#$! %     1/0)*('-.,+2     0/.1,&%-)*+('92345678$#!" ;:     #!   " CA@<=>?;9:B8657dcbTSPQRMNOHGDFEIJLK41-.+,/$&%'0*()32YZVU[XWa\]^_`e|}~ZWVUY?>:;897@<=RQKLJIGHNMFEDCABOPSTX|z{trqspnoyuvwx~}`\[a^_]mkedcbfgihjl     FD?@;:9>=<ACBEGZYXTUVWKHIJPQLMONRS]^\[_~{zvtu}olmn|kghijfqprsywx|}yz{~vxwrstqpounmlkijhgf!"# $&%  '   .-+,21/0)*(3DBC@AFG?>EVWUTSRNOMLJKQPXYIHZ[<;:\=9uvtrqspxyz{wnom~}|edkjfghiclb_^`a]+*#"! '($%&),10/.2-    5 34LMKJEFDHING?A@>=<;:BC9SRQTUPVWXOYZ[{|z}~yonmlkstuvrqpxwjb`a_^efdchgi678]\98:;743210/,56+.-! "HGCBEDKJFIM@LAONPQUTVSXRW%$*'()#&Z[\]Y`_a^ =>?cb e<d@LMNKPQRODBCXVWJIHGTSYUAFE~}{|zy`_edba]^gfc[h\Zpqrsomnklwvutjxi?\XYZ[WSTUR^]_`OPNcdbMLVQKIaJ~|{}osrnqpmjhilkgftuezwxyv     xyz{|}~vwpoqutsnmlrk! &#$%"+,*)('     /0264513:;<978.->=SYXWTVU[\ZRPQO`_a^]10/2.-5643+,*)78(cdefbihgjIJHLMNKCDBFEG;:=><?9@AA?@><=LIJKHGFDBC8764NE:9;M5nomkjligfhsrpqedUT[ZWXYSVQPOR]^_`abc\ut-./0,3+21#%&$()*'456"  !    87 !#$"&'%     xwvz{}|~y('&+*)$%,.-#/"09:;8>?A@<=BC4567321GFDEH !COUNTRYORREGIONTRIE_HWX5 +yARERRRORNRIRTRGRURHRLRAMRBRDRCRISRAIARRUUIETZRENROLHALZYNGOKRRYLYREPRCTONINEDNSBMMWRMVVRVUUSOMSMTMTTWWSXRSJDGNGBRYDNPPPOSEPEPPOEQQQRRFEFRRORGGS.HDMMSHLHDTDTCHIUUCCBIULLVKKVIKKWWXKYJYJBYJZAZIZZ4K'k     .Bl "(03:<GHRdK%R)X *(c 'U &$ $  ' #" m" x N j=  !&Q$  ~) , O  #u'$ %F5qq@1 kD<uN $ "3,^2aZTyp&  75[j A/Z0+1; !  & 29 lI_PLp q  >6" H*Y< [ou #? E R $'G%o  -GM t Ia /@W+F5% S"   1&%.!   V!K9\!7 8) G4 =)( * 2]l  A  " J' ޥ.*OBE*/ |9(  1   "Y54 =-DC3  00 }r( 6 Zr - ?; b  Z`Q CdX 5, #g: ){ Lq)  &`r>% 0 (*  2 ,J.HJ':B +/i\`5h! *  Bz;*UDr^  uW-4_:F.]( Mg f   v6P <  Z4 1#T!%86l * EdVS 73 As#+ 8e 1w  >n?*3  C % s \ @NEGFLIH=>A?@DBCKJM2143+,*)<0-./756:89;TSUV_QRPOZYWX[\]^}~|z{ pqonyxvustrw(#$!" %'&dcba`klmjihefg|{~}zy !#$"%  .-+,'&()120/3456*QRPIJHNOMLKtsvuqrponxwefdjihgmkl]\[ZYX^_7W<=>?@AB;FGDCETUVSa`cb9:8n FNME_AMBIGTRIE_HWX n{)ERRRIRORARNRSRCREMRLOTRRVRARNCRLIIURHRUGLRNNOENTATSPNMPRDIRAMIDMACKRRLKAKKLKKMJIHHNNHHGGGFOEEEOOEPEPPQRRDDRDDDCSSBSSBSTBTBATUAASUUVLVWWWXXYYYRY.N Xg)%  6",4>- e Y Q ^ fAFo\I& >; r5 4,  y!S+u<p' W93K 5 +*j)aE=66X.  Mai  0v ZT$  .,  (V$ *n]G2 DN% #mH C3 x b-`[8BhM1 )aU1l Rg k: & "?_f20 #cJ?zq/7d "'w( O4s?L7 YtW/ A !Z@ 'a kP% knfde VUST! MIJKLYWXZGHEDFBC?@Am^_`abcji [\]lk"%#$&*)+('7643582,-./01;<:9=>ROPQNhg9;<=>:A@?CBD  JLMKNSRPOQ[\]^_`ZWVXUTYdcabef-./+,)(*&' !khijg#$"%EFG123456ml87IH0T FNME_UNAMBTRIE_HWX% T lGQL9ERIRIARRRANRLRRAEORNTIYLEEEOSAIDRLLTRSRENAHRORURSIYDNAOUCRMRTCNRMSGRASMTVYYKUOAISDCDBVCBRSWGINSBANEILSHNNFRVRNHEIYRIESKHMLNRLMIPKRAUHGEOLFKABSSPNYSWRKRGSITTTSEYENWTMGZEOWPRPALDLRAZCLOVFFHSLOMDTYODSMSSTDNDYRBIUTDQRROYSLGSRHJHIRJBRSTSJRXVULGUOLCTZFZZRPTDSMCSQZMNDOSBRNNNCUVCCCKJXIXIAXHDGFESESSQTSABRBARQQQPPPOUBUNBAACUMUUVMMVMLCVVKWWKKKWWWKKIDXXRDHHHGGGFFFYFYFSZFFZEEDZZ  " e 9Lv ZA j} g awUA  i.K!T (c c } EI; A n/w<  )! $'+"#(/R%,345=DGJ^fi&-6789;<>?BEILMNQV\bjstvyzFGK$Zs6HEjki$f쀬he@gcLd.bzrale^RR_N]<\:Zu5YD5[3T!%S9M =<0+ V(P*`4!190<,hON'< U. @l $E982 - FC* -j P%  .$ ;'8ƳjM[;+W] kKS * [b +Q*(+* Y0!%\:[3T_?b (: ? 1 *( Z OB *IZ  &$@I )=6( '#E+  1r= y? -Hh 1 E  0. z294+(> )QpA >*).,(' kOyZT,2%  d & 'i %_ ' {&%,B27?Cn8( 7' B   R$ a ="I e- -  21_"+"2  B!R4W!&R O (9#" ~3% .0 $6 dd 6! JT % :3 \%>TW;: WR Iai'"$:+!P)(X'/g)  '"68 i(, !"a?  ##0 3y~[`  } <" /tP  3 S % =+"΢&? -'# @ P C5+  :EGm/  C#-' ! !e $ c ), .#m $/i8U A < &5D^ 7 /3Y *  'ߎ7 E )  ' 6Qi @#F tg F ,%my'X+d:+-VJ@F< $L !6 $ PlzDup5i} 5$PL .@uD9I G/$ BM ?3   119 >ITT$  * * N  G *  *=@ l .0&k5Gx](>3+*; F ! 0\15h !-1 ;; <~.6@ E8O47I$YhZi 7*\EN+ W(> F,>/ g:O5Q ~ilMs  # +* @ Y51#  / 6%F֩1 R   57Z:,L`֞ 2i#GM "q 0 c2  '~,#3!"GP"@D9 < w !0MD.'{ H(0 7DY S>. 1 IA5(kNB?/' /5( =<D6 AJ $&  (+"3 J]b('7O % fZb:*) /X((o & 2I KSf >$?30 ) J$c\ 0  $Bn'8 F@H4kW*,  P)3F8s  S E QrCgOyy)oY +*5* | X2 'K NH4R+$'2.I>"!9'E'9 uv h[M =  C' C :2 H4&?B ?03 "f  K  dLD 9#B.pA"f)|<%"oD e'< 16 %5W\%   #1uD dUK  K]b0"V= A$`O^ rfJ :K5l6E vncF[_cs  #( b,-FX u`p{ *, 1 &Bn -=  w Om F 42"2'T- j!47:#[ s2V\ 7"/ G0M0L)K<2?We H$ R 0 J 9a8Y8 ,m -j:!),%-$  2 -\EY\E3?p+t?A @$; ?M+*]!( KS ? K :!@XA<(+& !  B$"L -@06El"( VM h-3o`i7 S%`"@=L&G*3 W IO I/+S'>,f ra A *"@lL@5| Y5CI )35 ;;& 5C#4E697+T 8%  i 3-=Kg|  .@$Lp'Fi]U=.N gtm eE 2 84 F a"R*B/ ,4!NE<%6[ 0 6 D+_6- H&AC &A+TT+*T N?Q  3 PX ="d $5{'=]&:/!CB2))$& J"% [S  ;w `+' F 06 <&* 12P AP  :>} >,K ? ~3IPFxMf"+ad`-1K  >'OM) / 4X& f0&1P6#$ D.<HP #d D6@!L  c1H4&  $ <&>5 _&y 18\3"T"W3 *  |x O e (<6<  ' 4C\3 +K=K60j;Q ;;5#*,H82='Wk^ $. -cL_oC 5K4$-R ( 4* ! j/= p "h/(Q3<#   1 . 0 M$C,q&_ A> .   / ;:71e ZAx &   9 !# /r @. A44 |KSLLpA:Ab$vA+)- *-L| %#/ "  -m=U.;24mr9"^FFA[; ,_ C'a{41M/!,R*6 )&yw z.9. "HG%F79J%5r*X &B+/&GG= #2 BA 3k  N#8,J :8<L   t?J%  !%#-am G P j $   1J7((Ji (x$ ' UU(2n h  :k #(  =  #M&  C1 !9H #. oG% !32&> /TQwJ"I Ja"-1$%0 +"8 q@& 8):r/+o8G`{M%J:o >[=F)? :C^4GO [Vo%#> U8ĄL958 b U,CQ  .d$!I # 'HF * AN V%   ,X :ET'VD     ()'e!wN :vcC9  /! ? &<!9 H  09dJO-G,8r\x [^3 H4BG =)8[y = :I-j?F72 CB_,X;%% $&HNCB#7G,   a )0|N)/ q6" CB%4*sЎ 12 +,(8!*M":4 E z I 2!o Q)Q53f; LYD2 s  ">-5b .0 @ e  9\ wo 7!  DOE )2{ -&GD 7<G7   B  m # /B0E h& x> t/1,^ qCH"&e/ $g2vK0&   ( R9 nU4(# #$ U ZXZ L  >.3}< T.>NcO%[ '/0 {s |%B% ( h ;  .R! +, 5V G.< Z v "s Q,^Q\%  - 1#*. '%C31"/  f Q aE U1@,Xv) Fq P . -0  D nhhf ,]&J7 14@ )b 7 '8e  ;F/(+ d #4XAb? O /$%  D6!');4/@M  `n L&Q ')}lYcs8) }%2HVb# 3O 4(S  $ @ .u6EHBI NV  W-D (CD;)A)V7>7 ! "&  V1 ! DJ"zN#?qJ$N#;( ;"N#j!2B ^,^0 g5  #q#OAWT lmhinopkjYZUXWV\][OPTSRQNrqtsyuwvx12     0-+,."()*#%$'&! /LFEDCKM875634=;<:9ABGHJ@>?I}~z{|egfa^`_cbdrqopstvxwzyu|~}{.(+,*)'&%$-      #!"@?6;:7985132/04><=YPRTSQUXVW^a_`b]\BCLJDHGIFENOMKAZ[}xzy{wvu|~stqfghilnmoedckjpr~}|zytrsqchgiklpomnjefd{`_^ZYXWba]QRSUVT[\vxwughf$#!%&" ijn     754'(-+)*,123./06dcbe;><=89:FABC?@GEDPOJMLKNIHYX\Z[^a_`]UVWQRSTmlk              ! "      # $             ! "?<;9:=>DA@BC*+-,.'#$%&()/867540123GHEFab\^]cSXVTUWPQRNJKLMIO_`[YZwtsrqdfeghjlkinmpouxv}|zy{~ :SNOMRPQILKJHhfgTUWV\[XZY;CDGEF=?<>AB@^a`_]jiedbcxywv|}{z~sprqtuonmlk +%&('*)9,-.6754"!$# 0/1    823r~uvw{|zstxy} &%$+(*    ') #!"Q,@A-687120/354.FD;9:>?=<CBEIGHJLKPMNOyxb`a^_fdceg~qnmop}ihljkK$%"! #&('-.)*+/,   FGI610234587HMDE;9<=?>:JL@ABCrst\][WYZXNOSPUTVRQ|vuwz{                          q l j k s t m n o p a d b c _ ` e i h g f r  ~ | } { y z u v w x K L M O N *$#+"!&'(%)      PONMFCDB=@>?AEKGHIJ984312<;:567,./0-L}~etfihkjgwuvqoplnmrs]\Z[a^_cbd`XYURTSVW|{zxy     XWYTSQRNPOLMUVGHF>=?@BA<;:ICDEKJedf`aZ][\c_^b5478%)*&'(/+,-.031296 !"$#mpnoqgikjlhF E I G J H J D F E @ B C A G H I L K U V W M P N O T Q S R Y X Z - . + , / 0 1 6 7 % & ) * ' ( 2 3 4 5 8 : 9 ? > = < ; ^ ] \ [ S P Q R 1 2 0 3 8 9 6 7 . / , - * + ! ' " # $ % & ( ) 5 4 = > < ; : D C B A ? @ hprqstuvinmlojkwyx|}~z{gPQNOMUTVSWbadec]\^_[LK`YZJRfX     "#!&% $()'+*-,261453./0ejkmlniofghvuwpqrst|z{yx~}cd`ba^[]\YZXWVUPTSQR_O      !"#$,+)*%&'(&789<;:=?>6534SRQPLMNODGFKEIJH/*+-.,Z[Y'()AB@120VXW^\]`_CUTnstoprqulm~}vyz{|wxjk   badcfhgie "!$%#  "! $#   %(3/.,-021)+*786<;9:&'>=5?4AB@CEDGHIF                   + , . / - 0 * % & ) ' ( $ # ! "      3 2 6 5 4    1 q}y|{zustwxvr~     RZYX[VWTSUdce\f_^`]ba13420/.765?><;:=INOLJKMjkihBCEDHFG89A@gQlmP     z~{|}rsqpwxyonvut#%&$'" !(*+,-)PQRUSTLKJIVWOHGFNM7DBC98:A;<?@>=6453[XZY21E0/-.xyw}|vz{ltsnqrmpo`abcgdef_^]\~hukij     "#$ !)*&'(-,%+6503214/.DEFGABC87:;9@<>?=JIH 0321567:;849-./&)*'(+,%$"# !DEBC?><=A@IJKLHMGF    N7 A F G H E B C D = < > ? J K L I P Q O S N 9 : M R ; @ 8 m l k f e g h j i o p q d b c n s r ^ _ [ ] \ Y Z X W ` a U T V y { | z  ~ w x } u t v -.'()/0,*+1#$%&<=>?354789:;6 @BA2C!"PQRST[YZUWVXKLJMON]a\^_`DEFGbcIHglhijkosprqmnfdet{|~}wyxuvz     )(*'&,+/.%- !#"$67821543;<=:90afebdc`_\]^klijhmnog{|}~yzuvstwxrqp7GEDFHJKI<?>@=A8:9C;BQRSTZYNWPLUVXMO[hoqpnmijlkrswtvuxzy{}~|OPNMSTQRKLZWVXY\][Ubecda`^_fg                  " ! ' & % $ #         + * ) (  _bdcef`aihjklgPQRSONMKLYXZ[^W\]GDFEmnopIHJVUT?>CBA@> @ A B C D ? E F < = : ; 8 9 2 0 1 3 H G 6 7 4 5 M L K I J R S Q P O N - . / ,  NME_AMBIGTRIE_HWX4 fjx +EIERLTREIRTROLARLRNDYRRSCIESNNRMSRORATACRAEOSREECDRLSIYHRGURUKPGRTDONRMCEVTMRBRDFNNGKPRNGRATLWVRHUESKEDMBOKRFRLMAKLSSBOLWMTPPHVRKAYHNTPNHZEOMDGLAXIBTKDOKSRILGEHFHUSTSTTUPSNSLGKFTYRRWRERSWHCWYREBVSPCNWBMDSRYDDUADWMSSKHSMCGDMSPROSESBLHLPSIVQROFIGWOSZVBBTKOLZPDKNRDRNKXMTPSLAJRYKOCUNWIZANZRASURXDMGSRVFSSBFCCZISZQFQVISSJPIHPABHPFBZAHGTFOGULEODNEWMAUUSTVBSSSBSRCCSCQPPPCWWWMWMDXXXXRDXMLEYEYKYSFJJYYYJJIIHHZGG!$*[+u ( *>(g(^$r S v$H*#^Z(">*JD$Of*:%'((=w* !j(O*'t$ 7v( G+((nt*(h&    !,#&.)@%+0$'(*29;?f"/358BGHS[^_bty~1467:=AEFMOPQTUVXY]adeim'G\"8<LP*$)Q=`~&f}f<|88{zy xCuvw4tsrr MqE3;D35h0e"*D%I1 K/&M a)[pf;m3d1B*_"Y"U O&LV8 M .)"X/$ 6lW. 'Vb5  C8 $o?2` 0YY52T~ R$0^ 6U-]Y &Pc $"~D+QNH FX  "/zZ-T.01S@2Y (Gpv] f1~L$gWHT(O3*15  &M:@.KX 7)"./,.'$o;j;F1r2G]!QF dE1U ,2 NR$^&N (9Xm A ,7 )M(:. '!%HA ! YY(o$   "& <  ]LX^?N j  R$ W$G DG$ u .9(:+jJL2.?8 L+L$#,7 9MH PC\2Q 7 KA x# * 6E (5 .*F  4[CB%91(iQ7#D!2 5 Z8Ri\=< KU 1B= A 4 dq 22zv3T CB  S@ Gs9=pA/ ^ n) { 7%"W ' ,L$75:[5 .6G   @ e@-IdiM1(DS .2O%&)213] /ca (- _"= _ " 8X%2 U x,6$l =! OI*6g 2"  $0>  O" :+*"X   D- <81(k^OkD3/=g.B $2@LaS' J  ) &4jVSr=}  "Fo  QHY53?A 9 %|$0g6#v%vR %  A0- e ,R : -S "~`~+T(0"$! '.1 3? 4 )   di2,D- $CQ25CLa $ ^*H"R(fd ! 'H;&DLK?J%a!X3A 0 9 s B" F   / 4 8Cb U dHBXu m :+wRY E+w%32:, G?"nJ- ͐-%EV2*K# +(?%+U 5$> \P**"F &)8l $,": ZUDQ7+U^K;xO!-'h +   F ; ;2!"dq-  'I fDJ  $3! U !+Vy ) " . 6y&  TXV" D>]#_` )c =] Y-I0T 4) &<~260!^ +&'#5+|?T ,5"kMn;l4f E/P!s6 U7G '/, #8 ";f&s\ VK0{YY   'REP 63I '&%@-K# ~(?VrE<_7.   -  .$(7J*"3!  +8 V 6_ K0AY 2Q<&#Sj#WIb $- ! )f 4;`[C'&0_64A ZM> *9% I6'N4  % yTKd+ +  4| i & (y=Qz(}\K 7f+%z   b1S! OAk 9 /"#g=8  ~@#/$Q"v ` G9  B3 (*R 6MF 8  ,. , BW,(dQ b )&c i (\,*X BvBO1  "  /  #<'Y od c>)"&1(P: #_HBAh-]#(4.Q0yT5!'9    ".9 @1(4%- 3]d1(P. c*Q Hi5A7/M,*- T   n@!#<$T3!!WIMp^N(4. (6 !"70kM#7j0A"/\(AC H,( * bJGC( 0  )(o4 C&V%Pl{v.}W&Z03#7$ 3Z & 5%7+$ZjL@eZ-eBE(g"& *F  fj;25 e  \(KPPe%Dx\Pm8%?2*C ,gN  f) /l8 0S 0 %Wa 9 xh$|~ !  05  o @> N"  ( &*.'Q6;)&nvEO- %E'81$ [<":,P5.5 ) #<9* F81 @]<  HAJI1 M?/  "Mz b   p$6 M@kw@o2a.]%3(6)! ? !   4& /s1 -c2   C%V M:1l!\I.Q cA< | C / %\Y(:,a!IJ" R#Ssw/ c  2o,m/6 G'!! ' CR.7' !# y'( &"/  )&El"!, *0<Jh 2#  *--DJ 9 = ]L  6T%ZehNSh R _JA  &jse'G-oJD !2a 0^Qe2% 9 oJ I0, OQ  ) 4 &- =5CK+ h|hHP&+ u NcN# HG 9.7M 3T-D'#UJ%W = 7 Z,} r%+-I^NL$U2+1G$" #   /fy8%)Vb2%J\M$T3 c+#- #8V, ? Ag#$H#   4 [&E!#(k%y' 4+ wR -IHbJG;1#݂(F)[fVb:k@r! >7&Z ? 0Dr> ?<=2>*2#G  &CM0>}$3 !J  3 &,4 $g"?9b4C,%/[l,u$9=S/7) [ &"CAt  ML!= 7nJ}-{etrA?dp 9$O u!.? S BDT P>.9 (I - ; [)j;&fs*Y @LW EO+"#`R\h$LaVGQq p ? @-  9r ]E E74-k; C f` P9~{<*V +}W':N*@+DZ/$Mh ^bL a0z'# '*?& ,4  C [;EE!< ,U :,?<+bD2h2P $yT3) 48`@% b#R3!FaJS } +m?3ct2%.2@4   [ /) &;`-0l{Eg!xR':%7w'7I Gg!_.c WI- RTHB' \6> ?*B '# ([& `C;)f  'Y4"*x0/3 HA*x\Q*3W]y<!IKA,wAP((1+kt48)C M@=cg$; D $ByqND 3N+%1G#:N5&5O&/ ;C;>)'!1)rX3Nwe%2%H '#+P% w$/)&o0@V{xI#Jm 0(! ?!4`"!D/>. 8  `u!"'-#>515 ".V=> ;Fo;\v>(QZHA3',*R[K[>(3dSY153  #+}#g  *{!.1e  /8  )~M@M-WT^7pA," 4_mZs'+ >(;y#>.G }m   / !SVKPi7B' 0#*:'~ +Gx'5dv  [P$< (k6 %T^+6#<#   |(!7)ti. SuI (} "B$) '/$S#Y9Mc# =g.0F"!%t } D>.(S*(0 '2#Z?"112 %E B),7    @6@ E +   /9 )) /s z3] 3#, w s&H!59A <\#9<  .&8 &. {X%0An Nn"]L v!\[" /l)c#_j-E0S%-L_:,(Sdi9]  [F/*{s)M !#3$wZEO!W 9 HA?I> ;F+&; jVKk=%a%NY:9 D$ a^ =5cF / D/@ 1(Li%@0YR##$8"%6S;8o.m %V6Y%dB 7R U7$b}e#*F*)[%Ej4 1 3bD&JHb:)^"<$8N ._  F)C4M{r>*FN Uq%p 6 JYX:PIJ,  D,.x:p: 258!'K*@   ) 4&8I=gZJ% D"Br$h` NqNh"+   n *Q /'4L$U#? H+|BX *P,+ 4%q>_; +05y, :*#(- 53   ( # GqH, F~M GI9 X(q:z#$ /086 `+4 C;)&/fL0WlLa "4`8*x U |O' cI8&M32l a" l| z/ G`u= (k *C.pU'K+J 3<<2>!; <P%9  X _( [dMp9= T& wE{22 5:[; +k F B41(4\2`Y#OKN$l!,O G:]?F!~ 7OZ1"W"F3.W2,9  M a!Eg $U  BHbF6Q $' (RI & C" y5Ql$-6NPg!* ! $ )!7 ^ <- \e()    ,*1#\Q= *3P } .7fBb K.7'%u_  ( ;   4[)CK`  0L"!G/  (D$P 1}.(1&n)Q@#J& )0VN 1UV./  ;  )4'V- 1']$ z- (!, 2m 6 #  iS,q  % 6\aWB96 $N  t. qPPXQb!XpvB5 " 7S= . %(: 0#=ZT7<^  ̦ bJ'A );[4  z"D ?KI &+CE*' ( 9. \=> *%E,N  =vE%, +W i (5     "! Q~zytu{|}wxqsrvjklmpno`abcdhg[_^\]iWZYTRSUVXef86754?@B:9>=;<     $ !"#C*)+'(&%,3021.-/Ajkmlnvxywz{|efhigstu]^_`acbd~NPSQRTKLJDFEGHIMOrqpoUVWXZ\[Y}|}~y{znlmowxrpqsvutikj^_fge`abdcY]Z[\hMKLNSR" %!#$('&*)+,0.-/312NLMSGEDFRXWKHIJT!#$" *+)'(&%,-   3./4120BCA@?PO  :=>;<95678VUQ     HIGACB@?F;:9><=45678JEDPOQ | } ~  s t r w \ ] ^ ` _ x d a b c u v o q p { z U Y Z V W X [ k i j l n m h e f g y Q O R : 7 8 9 ; < = > A @ ? E F H G L M B D C T S K I J P . 1 2 / 0 4 3 6 5 N &'),"#-*  ( !   +%$                          w v u } ~  y { z | x n j k l o p q r m t s h f a b ^ _ ` c e d g i  , - + * ' & $ ! " # % ) (                       ^ _ c ] \ ` W Y X [ Z R T U V S d b a | } { x w y z ~  l m k j i h f g e v u s t o q r n p : 9 7 6 ; ( ' ) + * & 3 2  #   ! % " $  - , . 8 4 5 1 / 0 < Q A ? @ = > B C D G I H F E O M N J L K P !      cbda^_`][\}~sutpqrmonlwxvy{z|ijfgkeh"WTYZSQRX157846023OPN9;:<=/+.#$%&'(,)*-JIHA>?@BUVCGFEDLMKQJKLPOSNMR@AECBHIFGD=>?TZ\UVXY]W[.<98534762/01:;~}pvtqrswxu|{yz 0 1 : = 7 8 ? > ; < 9 5 6 @ A B 2 3 4 ` ^ C F D E I G H _ W X [ \ ] R S P Q Y Z b U T V J K L M N O a          ! / .    - ) *           , ' ( + & %     $ # " c f i h g d e v y w x | z { n o p q } ~  k l j m t u s r |{~}srzxtu^Z[_def`abc\]wQLMPJKIXYRSTUVWNOgjhiknlmqpoyvB@A?=>GH1-./02%&# !"$     867345;<9:)*(',+CDEFL[TUVW]\YSQROPMNXZ0219(*+,)8756:/-.34'#$%&^_`abcdhjkegfiDEHIFCB@AKJG;<>?=onlm~}wxjikmlzycb`a_^|{stuvedfghnorqpT~xvwyz}{|Z\[XYWUVdehfbc]^_a`giujmnkltrspoq }~{|z463785    '&%$"# !)(+*.,-0/12\Z[WVURQTSYXLMNGIHKJPO?>DEBF=<C;:9@A_`]^axywfdecbolmngjkhivspqrtu0 1 % ' ) ( & 7         5 6 * , + ;            : 2 3 # $ ! " - / .      8 9 4 L M N O R S P Q h g o B A C < = > @ ? E D J K F G H I ` _ a ] Z [ \ ^ i j c d b f e k l m V W Y X T U n p q s r t u v w x } ~ z y { |      5349:GC-/.120B#"%$ !F=>?H876,+&'*();<DEA@     NPOJIKLMRQvutykijmnlpoq`bcaedrsXSYZUVWT[^_]\fhgwxz{~}|LKJGHI9;:76841235DFE>?@<=ACB     PNO"#( ' $%& !cdb]YZ[\ijmnfegha^_`klsrvqoptwu978/021A@5463:;*),-+.><=?FEIHBCDGXWJKNLOPMRQTSUV|yz{~}x*+,0'& !%#$"-./)(M                 & $ % ' ( * , # "  !          ) + A B 7 8 ? > ; < 9 : - 3 1 2 0 / . 6 4 5 @ = V C S O P Q K L N M I J H E F G D R ] W X Y Z [ \ T U +)*(-,$%'&2./       !#" 013}~{z|wxyTUVNOPYZ[5469:<;>=78\HGBA?@CDFEXWJLKMIQRStuvr]fbcdheg^`_aqpnlmojiksDEFGC@BA23654/0-.+,*897;:<&'(=?>KL$%HIJ1)|{}~oprqxvuwmnlyztsQRSTP^_`]OMNZY[\UVabWXghfdcikej !          " # $       % &    9 B C E D G F L M K J = > ? : ; < N O @ A I H ' ) * ( + . / 0 - 4 3 5 8 7 2 6 , 1 U V Y Z X W _ ^ T S Q R ] P \ [ d e c a b f `                 g y w x u v z { | n o l m k } ~  t r s h i j p q   "#!rxywzuv}{|ts~;decfg_ba`^]R[Z\VUSTYXWIJKLNHOMjiklmnhvustqprw}|~y{zx@?=><EDPQGFABCo   #!" 34782615&'()*$%0./+-,:9           !"#  &%$IKLMJ?@DEFHGCABN<>=,-+.2314765/0(*)"#! $PQOSTUR89:;Z[Y%'&WVX`ptsorqhgfijmnlkcdewabvu{yz~}|x345)*+8712/.,-(06'LIJKPQREFHMNODG@?:9;=><XYSTUWVBCAZjklmnfedhigba^`_qpc][\o]^\_srt@ i j h f g c e d q r s u t o p k l n v m ~  W X V Y Z \ ] [ U J P Q M N O R L S K x y w } z { | ^ _ ` a D E G F H I C B A T b             ! % $ # "   * + . / , - ) ( ' & 1 0 3 2 5 6 4 8 7 9 :     \ [ Z X W R Q ] ^ U Y S T V J L K N M G H I P O B A D C @ ? > F E < = ; a b _ ` c k j h i g p s t q r m n o l w x y v z { u f d e                 i y z { | } ~  x s t u v r w n o m k l j p q Q O P L M Z [ N K T U V W X Y R S > ? H I = @ D E F G A B C \ ^ _ ] ` b c a f e d 8 7 ; < h J : g 9   * + ' ( & )      / . 0 - ,      " # $ % 4 3 1 2      5 6  ! !ZY[\PRSQMLNVWXUT]^_O`a:@A>?=<BC;DIJKFEHG8934765klnmopqr"#%&'$bcde-./0suwtvfhgyxzij,+12*)(~|{}     g h i f e d k j X [ Y Z _ \ ] ^ I N O J K L M : ; < 9 b ` a c 5 8 6 7 2 4 3 S T R p o n D C V U @ B A G H Q P E F l m W = > ?            " ! # $ ) * ' & (          . -   1 0 / % , + u v w x } ~  | r q s { y z t     9:;<4=6587+-./3,021DGFE&'% !"JIHCB?@)*A>($#     NVWRUTSsqrtbcdexwuvY[\Z^_]mnojlkfhig`apPQOX{|zy}~KLM   ORTSPQUWVXZYfhgkledcijrstuvpq^_[]\NKLMa`bFHGnmoIwJxy   ~}z{||}~uvptnoqsryz{xwTSWXYUVZdfecbNPQRO]^\ilkja_`hg[mM     -.,324/10)*+('!" #$5%6&AGFECDBIJH9:?@=>L<;K78)*+'(,.-&/%0" !$#435621}~{|yvxwz     7@?AB>C=<ED;:89   {yzwx|}~vu#367845=><-/.'($&%01)9:;2+,*?@   !"$&%)*+'(0,-/.978:;65# !"4132     <=>yxz{|~}rstopquvwGHIBAC?@EDFPRQTSLKMNOUVWJbefghidckjml^`a_][Z\YXn!" $#&%()'*XWUVQRPIKJNOSTZYML./-1042356,+87>?@=;<DCAB:E9  fghe\]^[ bdacGHFlomnijkpq`_                 ~}{|jlkmpnosvutwxrqyzih`dcgfabeCFDEGABKHIJXYZ[]W\oqprndefbcjihQPO^_`aklmSTutLMgNVsRUQ[\]ZVWUYXTS^_RDEF:;>=C<AB?@1238754096GJKOLMHPIN, + ) * ( ' 4 3 5 6 7  ! # " 8 9 < ; : / 0 1 2   % $ . -     =   & > ?   | ~  } #$%&"+,*)./ !('-T5 NME_UNAMBTRIE_HWX:S5vd֘EREIAROLTIRSENRRAMRLRENRAORLIHRTRURSTCRNDSRGHAYICWSOLDBKBRUROSFORCMNDRNUEGGRVACEAMRBHYHDFRNKRTBYVZKOPPSWEGZMNUNNSESTPREIRSFYAFOKASERLMEAEITWRSLRSVRAERDHKIGENLSLZRORZTJCAYRIHLIPMITSSSURTSKNAKRBTGVAHGPLIONISDTOSLASNQRLXFUMMROTLHSSNSZCPZZWDHLXJRDWZUDYTOMGFIWMBRQIDMSSKFBORVSKDTUHHPBYSXHLMKSGDOTGYBRZNPSGEKQKAUDSHKIHGWBJSYHYWWMCBGMPQGSPZXRFFEMJGTVKCDEOAPIOFDVVBXZYSPUTIIZCSJFSWFJQNBSZSYSUCUEERUSOCKPXVRZXCRAVNFIPYYNBBTGRLXNMZYFXWWWVVXUXUUSYSQQPOOLKKKJJHHHZHHGFFDCCCBAZ'ZtΘ]|fu}vCuԑh&CFjx~͑yy!Ju"}z"aB[tN$:t{wIEl ~Wy2wvvF9}]m}SONTyg$1{>+'I#&`lY,zjt(L%pX}zmPvlnA'%i{x|,8'Ckݑ)vl*)4hDftJ%v]n!4%Q t;Hv)+]tU %3f@)T{{,elf|~}tȖyDiLP~8SuG??UO r8l']N)R&%C" N>\"]!@"1E[yu"Du65{Zt P}4a{"D=T t#)"FiOBui~O|K>cʘvي Jh{rNP !d.u k|*tn ?q ,23 I gCiP/R xCxY$0I#RlRy_?HGF{2dFV{DXԘV|*!\S|]Tx}H]!!@MO!"#df~~dE~Ch$ah-?&UKJ|B>k Q9^OC&QMuN((xuQ(s"TYeI)1I%+t+B,1O2Km6J53;Dll &Jk]$5jxxdAgGC#BEf{B}}H |8NYV   "#&*$%)2!-('+05,69/4.13B<@AC8H7:>?FMY[DIJLNP]fkp{;=EGTWX_eghlqsuxz]KOQRSUVZ\^abcdijmrvw   !#%(,36=?GT^_`bjpz(,4:=MZjmx7  $hb 85NMC 4Dw;P*Sq"IUhmF+N(dԉUfQ"9&y$ "0(9Tnfl toT4=m:g8&;WH9T*5%f# s sCSr +=72HH# &0s# P ; g"* N+ ^&B.Ԓs !X>l2>^ D D)9 #_}D1$. 0'\ "i@?Kb2D0D|A){K@ !#_#n&.$_'6|5 E 68]A.q5c6   1"  *(5D S4+#H  ^#3@] H/97Y: [jo$prs 7M,/" #Fj. O`K s TC*%,T zWqp$%llEN:g (5VH[wIcHe u/lU[)1$z;=bc:{,z#(kH dR)OCΙX@u3=&1$b Ei` sa./3]' 8&,3/4H6;)Pb6";56*/& 2 $C!h" NUSD J^" <( &9 Tr95+HH G=! E < $ J   ~I7) 9 ("Kx c6 ;989E#F 5 -&#8,!B& & @ cc?"GkG#j9 "(  0=r ] iR Z i(g \  .8/( "9=+ Y&.< !KvWH83" (.?@j Z G [.!3* r :c!8G<[6/0eO 1D ( 9*hC f;U `j(%*Kgr) }Nv 81 "%(h=b#<B G . [WEvGK.O1n.Y{O  3 TM3 ':k! #W !? %!  ;" ='#7Mx% D# 9 %XA[ZG ] XF]Tj2  / %|=: 6( A7+P\,@2k3  8  \v P +A 'u$Ic'IB  ' ! ^!1$'m -vS3/>3<'Asɐ < ^L8H" "e {x(6 -$ G(&G*=s #"r4fD+ :<&?h 4N & X7$[aM%1$[  9\G   :2@ ;  YM$?uK?* g(, C/G'XFvwvF!6/ eI|36 4N  Bp @O32 /YY2O/\ !6(1h=^Z e1 c% > W2e }H/BB  I Fa&A"(9RJQfD  Z Z4)j%}gL4D ' ND*; f9 P 73\!;> ) 5q &B`" Dr _[+w Q :  _mo+ (v~^6] p[I:U>)  Q`^ Es> FoVG_9!eaT A \ **4"+4Yd!#1Ȗy[a5g2#>>':i  > ='7 ? KM W.@;+}&35"h*!$/[z< sg7 d Z#=bH=b'm ,0e  /j 29'.NB N1NO1  / WJE7* )  {P pa;cKo+ !#&# n4!A  + XN ' 0[-I[ u$  0^ nx  ;1 A7Tz W ); T9(2( (4 9 C f ; P5rDv S=PGHe &+ Cg 4P*1$ C&B?j(X'nIހ^ #0[rf rMk 8%'@< &'6 3D&-EB0 -z%:@%I 02/F@H _  & j-/*$sC%i1Qp6k'F" D\LW'M$ & #% G_ %0 A A n!s% G '<): E86 E, >i %1 2>!  :*xX4 QK 1pmA |yQO]V+0E P /.F/o+)   /WCtc7 <   %x zN _ 'FE &< " " e m1-l*$.Icn) K"F(;,c)`9]f:$4 +4 ; D+۷k&*M)*\g!#1*CAib'_ 0 /'Tx +_#tF% J 8 dJ&HQA"i?? & &"h  U 39(  "45f < RX@J H1$IN&6;&TJ !#BPB1$:1$v`  7!s/H/;[, J$/ L'Fo\ 34 gP*%U =J 8X7Aa .k%:_H ! p38lIX%7/AT> *;4 * *6P7To+ xF).+a& 2 < Bm Y@Jl^Y\ 45 =L  02&B/ m4~:1$ 7/%f @VU90EU!f $ * ;r(D:8%R2-<+Q\ gs*;Q,1$!#2<8Z^=b #mN .c`35}p ? _>)& .a6*s 9WF'8=A%]#- /R6;*4v},kIT2$ /|Y Tl U  V2:&&B$0 rL, =M7  '6lڴK, %V E&A(%?'?g6 , 32]$  -7[DK"e tJ -v6:d= ?q60 ) =(47!h* ; 5#zE-A 4  ; 41C1VRI&oI.7G D'^ 0L1)!# v[ #0g.&.SViM0cE# &>Kk5P D#3# \ 8 9& v~#8 Dl4'^+bB85  L :,e] D  !2kyK!)Hm"#Q,/X &de$& y1H "ALI` i".(b9 "c?j4 'P$Otyx'0*J '$22>V  JU  +B nHQ ?^u Z#)I 'm4KT(al!vPM?pp5~7WMB1$+'W!36N+'^cNe]S 1t =Tj*F/ + )  ;4g*+CtR=׷߰8A*5"c2&p{  L - #Q@<*;6 >J 0!# ɑ,+I u3[4+IB3&g !#pG< 01 w  g!2Ap&G!D W W }>"4Dog(MSF94UI5 f *P )N.LnA "7(& z9;3+S9\ hNUU %n  Wv FC5P&0  XC?5{' |@.F( Dzl_3] 7yL'H']^v=6M+@- {^a LTK(L\" "* ;4*D9N5hM! -$!hq0+o} v &6 H UP  M-&$ V0&d @8!# ~]vE L '`.)R 4) U9W"~9=v+ 77 J+l&4͍XwX8!##?$%XB/~^) 1 7B$,8L"(!9 Mpu_F9wU1%y8%d]LL+6?+~.}'t-J47L'J) 4Zk1nR|=O (B & &: M:~J YS*C$ %9-yT;t }7y ~af.$,  - -'H$]+9)~M -C N P  '9 *fh4 "DUS2<Qg+ N5uP V OA'?/^ VEbZ7.O/B:* "P 1+2I (#1y.ya16=KXm "  W u>< S 0:Q  g*,A=#)b>e1_I8L ~9 YR d+'#k@pagi - c>]@A6g /<' Y} )!"9' / {bBL |MY!X2 I1$u$5 0%UGO(z @\ }_b>H3P|Y?  5,'/WX Ǯwc6F%!o V TND"( ,994"08(*U&"# -5L 7  5>M(+QR2~ct+ ) :"` >Z??h9 4 j1 -j(% B-{ {=H1 4 Hek)?!>I(  1$`[lyXn]1]L'"  Y  < OJ1v$3 "%m,e11GM% Lh4(y8 LH  787uT Q(#Mq q  E+'L'O+ X  M +Q@<k - wA&0,64R2IJfIB 5c(J K-!"$ * N;  59UC*4f,`.y V5j&0+J3zW? * C R21QIJ q 6X3{(;=1+4I#3)? !/;a)N Y h'2e ~ \, >- 84 K? mC  69y$$2A `  E  ) =Kz>'0]jVGjTN , v@-x N+'2'A  +'/&  |m=QIQ-^ na(|U H $;c!Lq6I$~3   % z] >J# B[9 FD -`E$|cB/, }A9=  5 UC4hD* i ,S=f`)dOU" 5E;$&(gp}=0+'B/2Aa , z.6o^O< =b}tXtH UaA Q n|@y/de e26x3A" 59!4%6 Nt+  $(, >)pO),< +'yWLA Mq@/ G=27 (  )[!%t ,?/i (6( Wk,<1$ .n &$5( ; h [ qWb- WVvzB" 1$ }=b D~He  9   lJ8$-{9a MY7y3 A+ H] X3L 3. "Rr   WuK= 1y)6? 8 !G" =. n ! M= ,  w#s&6  )3' W*  5,r [Yy m;  (AMp S116 '^ =l 3'#m(l%6ZG  PXpOCx#-&V piKa3)=t-JI $#6w: )St-JT  )SD% &0  VQ b2ip: Logy ;0+on G%_ B2)@Y8 6b@ pm 2 =)q!@~ < E 0&08 (9C": 5&:l [+sM>BE d]<&60 +4#0%7BL( FB+ AX-E/!G< / +} 80ntE$; +'<    0 5S H '#mP v2YN=Q!RZ) SaVvZ298O32#>z2S\>) *<> YPtE +3oX2l26 !j j*m GH  =6O  )"GfS3( 0 .+n zb Fo ,\ !S   h4N  v+#@2 &B-[&% #-EdBW5T TYagG57 kJFA3 RASd-i # !# 1$ I = %? Ha>~$i:  O)7\gV_#JK xe$qp- G!H Ff's ap #@@]jAK)4 |h)z``8%7W0yCz Qp5E)5R%Z b2@c#wu7[G(%&"y& 1M.% 2% 5 J8: 6 5U4hYOpg%J:&t"h  6R&L3 ?@J m0"k$FO5F1 #7GxLH$]3IR  S%BYT% &R qS'@Y$F`08"& TcF & 6?"$W @(5 B6 9f $\& 1M0#2>^?AQ:*&6(:G+4/(!#5?N ;) u > Y;,E0^ )) $|/X`K%78 h =+jH:IJY=70   *5 d( v?:>0lfe d%6 S, .-# W`R v! #k8 8e15-# )-KC0,J& &| 8 =@)ALQ 4 &n1k.?D h^c/Q>:RPN>y@zgX!68:Ǎ~j .45 " !{]UE  C% |% k .AQ 7EF)"<(SP Qy/ LtQ85%i$DJw;79+fs #U *"C4N1!tM:J 2* " C;P5KBNh1UkGo+U M1X^ m!e$ W   &B %_'  :Z:Unl  dW;H#>- ! p'^ l$; 0 a<1$ -3  CS  B (". L w Y0,%?6 c'}|P{ E Gn Pb*41+6g LK1I+K 6_: #0 T&:  SN*lf- K#r >&30  -| #ma]/3i  H lPD'- % a< K  - ;y zZwBp Y ;%_`x o+q ua*ZU j6[/|D1Z0 IJ$;OJI&6$j1$ z ,In1$ %6~J&d nw e$):]U A* h  S  \C" ;4NP3i8">4f-|  "&0Y d>0'P !Q4%)M;'$&6J8a:m  r%*,<TL>&A)A6 104 LLP- 6 Μ(@[6,* NL'Vlf$~XJ$i )Z@8 ,;'atR" f54UCSh*9;!B L4*5 (C%= [ 6Z?"'6]6 ]9Ml` K/ -E1G:e]$ '* PHO&6ؤ #,n[R ##: #/a! LIn\ *   iUf+)'X^o+,c6Bb_^ I-3)f5a+6&1B[[I[   Z 7 $#},Fo+u S9#M<0!ovo P\_8a^Ye:"M "x_ R4&dL HhBy) 3V   !5.; 45"S 7)  ~O -  MJu6#w'U0*Ju( ,!V,*F $>//"~_ !+'H] U M;x2n.%?'d-KJa= ͜!/& (  uwi K+Q j -C5  ;* ghI! JLI-5k~8dW-aN x/YS V-u  a$  #* <3 $m ["x &P T2 "LQ T7/8+4E8 L!E+8` -5 e)"G/ k Q" (v9Ou)1S^57RN& h C #U 4S ;*Dfi,:;* $P s \O!#> rn,1& = 7  VkTQ17!dE1A  8*;e 1- Csr2#]%_0%VI>^ 7 !) C S (WF: $e iI -F_}(I!P4kY39!? YOYr6axZ EP %OS)!iEl>A (  |O  6+$>YZ(" 1/ * $ ?_M?" ( + k_ 6)85߯e ,  r( ,|` x0`)!ux2@}(I3,e359i@ W  G:z}m<G  NE5+\%" "; #  D * C 4U h 9,)0{s k]G']@zXH -#6^X0=; JyC-#!hE u  N c7-{7 "d") 8^K O!% @> I\'`)@k3o+qZc%MJ1E$q8pmW,32~B3ERCGN. W=,-,)=0   o.  !u$(\$1SC ! ' ~C4 5 "* ;;XH$"=b1 ! t cs&6X2)rC  #k! Ao+ mt) {| ?$  , ,ypo+-#? & 5yo+1$Fm7KR x_BO %` S'~-/+FK':</$ Z`/S$u kZ? c>TN(-{ ! 6ZQ7E M./9U%  N 5 4D ;f(gX, 1R*C G  #k6\ Q%`Qr͝}' # rE 'TN<5  iE!s&dH), !Z [j ,n:E ϋ&w ?U!CHe(V#Ck'6 !4J!M&6V" Ao+m;cWT |O$ <}R 700- P *;CD{=(S[h  X?RVE, z#dV73/ I_ +'#<3 z'Z'mX0UmyW/H% LQ /R ,-& W Q, B-[{\ ,1'U7$Z: !gl9CD P)yVB *6CO5H*).4 \ #U 9 D;(tk 'ROHe ?g & [\+ 8 8C(@&N& 8l*".u$ 9 +)2 </ c6^ m`0 m G `{Cb2>F K $3Z:^ 0g 9  +'2^ &11^Q : * , >B6 %2NVK, &+'$UPbp^>)!U 1#H)( * \ ".$VA@ :62rKa< RG_~DntK73I &:  Ka+K%:! n ^y : 3+ s &\<*U5/9 "  N;D4t&1 /[4oJ 9D>%RmU o+q p n  &0h(*V,O &Bk. }EV 2 1$ !V'T vj moQ-$# ?>>j,n +Qm#Q=+! 'F=c<ed?(k)PpJ^(%B!0<FT]UB! YA5F" .C hf4* DSU ;N>bF= ,O@A(z QED#mD4 ģo+,-/ 0$H8$g* 1l, LL4sX#^ 7]/D, !% _B.T .K t C"Hw%~w m+ m@>2X B/g ?M1>T RcE 6 ,' F-qN`/-' 0 `) K44 @*  ; N  SC5 R1,' GP D El2sOT23A ^cwK m+L# D; " %bH3} 2u U# -72;* Q D &0 %l^$& ; ^v! 7#cnl)+cJ#W' Q k, z 'A4X>v  LQ >`- 5$E >-[ * % C S 4h5;JTs (   B# &$& 6RٯF, % Ze , O' 9]N\27[l2KQw M!0Q- ?@C9~O~J0.e e< E(M @>]'6"(wSQmJjDvuP$ )(!au\ 5C9 ;f*N!2Her4* h;%uN(O # # ?"i)   4 :UJ .[SI-G  eh " NR 7&02-  [" r %.?! P ?.W?'-k 7  ) +JV >  a%?:+Q! q O q %N! W \:h K4G7:6",'N(K0.CV&G 15CDvV5Nftj%3RHg>~ 7=b+2)F#! 7A 'C l/8@Y,58TG2e% q'_  cC!o1$ N2@uEl*TS.3l ,x E e N&r` 11 ~Bj]+Xy{o+2:~:v< 8= h;SQ%*!!#&@8H2 m,(<>* " 9CU;{u~B$?l* "]3n]M >*% r1., xHQ& H  9 c]c 9*5 ,!#bc-q_ EEB6 Cj(J&  +H3 &E2p: ( g)1) n=,- !ljvU'_{X>Th< as\)koi !w{b!  z_yYdn VwHo+\5IQ  <6   Lk'.j F'&e1, Q:lyj% %TD)" # !( $9 KK91 =xwO(K_'@ AH %Xc# #HH3 I89  +Fk ?? 0O  ! I`pR2 %CDR  AtR23 () :XFw,G ,X>I$_I6i8B$4Z)JGv" (.# : 5 Vj4  +] ,+'^ ;`3 B_Apk:Z.d4 >``8( 9"a~?U1-[C - : -#s"( .FXZF7ew} G2B "(jZ HZ)"t(s9iUfBU!Ay66Ns5+ 3 g :4S rUh ;C 9 P*!{g%#R!A!#O+V%k>.i# !E d:!A ?"(59 +Q1 y 3 $l% 2#}.{Z0@A/~AA(s |rx'l M`w':Z =" [y8Fn % )!(Z -F#XTG4(5"GHT@zB  9NbK7 GTY{=' L '@<{Y7 !QI3SH.n d 6!s")M qi:3_H/5{% U' %, )nEYV\[&N) 5Ds f9U; , +r2$s1d, z?g]aNVEd:A V?GVd gd:(LV%& +xHDj0  O# B!-.T3h RLZ?   L' Z !B3D4o,T QJhWM805?UC9*(" 4 eW;f!/xOHe=# d5%@)  Ji.|G_#^ /6% Ez0-\g(3 W^cucB = D=1Gu7G3l^ )  0&d+Q 8Nl(886PRGSY'1 :a3 " ; +%  -:' ? ! Z+X73ff \`~c{'g%85'X<)X8 !'  !L fY/Fj.)` "9 fcf]$h&!!(??H.% M%+td8, Pc:, G*T/ : 05 g .BL >^ $.h 3č'Bv#t0 ! 8 H >p:4 ~.a"i!K. , 8sj=2#>#K@A"$ $t7@=7 {j~#'3P4^ O7F 8 P2 |&6 H$|:28_n I /ܰ^ MG  ' b>.?7.&_1 /" *4iwm B-|{| "r 4PAs gk=7!#)8M Z 0%'X )!=O#@K/A>B ??LrX'_-/#@'@) Zv} ?xjY*\1$p}> }x<|,t > Y)A !#C@>^<3,= d'I  %N::|B 33- %Kij+W2 %   S59 (U*z k= ! @K@" b87M&"E% } 7/D$7WK{Ee6 7>K8) +4 2  ;Sg( *kBK4Pqp-  23 ,r < Dm 3AP !%vr31= 8 1$,  >3 'A Rt%7Y R?%?,V " K7 Rj }I3. d(;5" (Ms."" 7Y5 47\G2ky % !@' K*O" !J,M N9C>HH$"2Oh :P l -H &+ioMXH$ % 7  p  -J F  0;1S 5L<= t+G k R=7?,M 2A~A  ! "*9&K G ~2X> :%@< jM)q  5z| Avz"(R r` + 2`R0'`b:g][1 -[9gXz1(#n<3@@F{F[OC('\5$`*X9F4B&; ,S *D %N  P f  " h"2)/C-2 %" "4*N xS s5(U ,BL%  g.'.C@B3!'d2>8RpPWY#Q6G" M- K %'@]7~6s5 + y#7W @AqQZ7bx?i VC(OAKw %6i/b 5_?k PQ lEr a|>TLo+[(( $V52$2O T  " -5  #4  (*PLRM -.j!(59 'MIb. -*5" (- ['/IK /r! )P )  )@>.E@+@B{}'29>``G@')h'_}R!! 7m78P 80az :1/g' 0x$[[:kG*/ *\gPO+K0F2#>.Ar (05)N/&R0' I(  N]l&##:uR)q %[ nw>0VQw'6M 6p m r *CW mqe?[  rXDd/j x BL3. .Vn9cqF$#@K D 'gC   L%, #`8v4\V16 &d-XE > >".,?`bQ"B "}G$ ~["  (5bc#{| WgZ M73`d*~c'x#@T cp,%0 mxG#'g ( A E$ 9 ( ?t,%b0V7S  AS9u+nC 5 E "IB A Xy.ueM q?8F< E  ͹J  &d)3J a#+A M A<T=Ue _F/ /H< .Q$y"q(@nD,f*X 7 )f 9 Y )4; *5 # 0C h D^v5 O/ls  5,3=AQ1 8@ #0 3.<Lr'a: Z0#.x6x_H ?/8#Tv`/ FP*h; (;>) Y^'m\F# ] #}O -/1$ 5@W,<  %? `/2NV- G   ))%I-)? V   H  $J!#+#' _F# T v9K5A R Bs%%LC "C*4;(B.K \ *5Oq cwmś $X- {BK@ C;  .l* C K& O      %af/C5(&6%! 5RH]  jx L'G|Eq'  9]<,"=6E%+ m9c) *  O%Xu/0_#nj J  X >$ ZFV !vude <&6 )  4&,{ /;* 4 P  s fD* c.-F  4 CUO,`)o+lX1?6V  ~:']<ea#|FO/" {M/0*!SJ$&B-. ,&&  ?! H ,T1L 1L8\S  4 4,T >7m DJc,]% mL{M- ne$  iu I&d  CD'  &dHI)p. #6Hg$ȫ," h\eO % ># )5<  ***)  m O48? ! \M5* fb@%5'TC"&d Yn'Tv[ | Y3YT <F#,, & $"# ,?,")x  /> 4 oJ["?,ӑ+#F3 ZG < F"b#(WDKCf8i7P9!cf N U%Jc5 3  9! NC ;S ! 2J "g*= R*"~JK]W A%zn%- -B_6" v[ xg F E"p{_<.?>~,L. "O N %'bM 0!#x@.K Tv X0  , $9 /@F$)\/5, *UC (f4S9 tvS=A `e. M?itr-3rr? s#X07Tg  l<,T+ 3M`J$;T )   +Q.3l E/ mT 9V#z6 e 6bJ0@8 A2$^.b0v8 K. (s-"  9 2JB3",]ev IjR @kI   !o@-. C%R<dGB@8qp-7\ 4  b?  J0o+  +73 7G 6+B9 " 8 !9 ( W4)9(w\f ! R2tR=7a(BY# B  \)\S g +gy8 })M~G~ 5N ?~- $.5"'vF%|7^ D-.) 9 2M/]Y5-3,1"5 * Ga~ .B  Oz %VbuWr$hD? s-8p{O%]l 1> < G`@0y%?- 3(~7/E2|p,) JL Ve )   ;4CS(HHN #'@<T %?v* *2> KLR - 'j;;UI7 q ?Vl~A! -!:4D $/M 4 a~11t -L PR K5'm m .3EP!)SE !oEJY)  C$  VE%v ( : n9 2 b.YB/L.j( WBLqc"TkRk(KQC9.]"  ( $ _6!/?*7o= <$5U?GJ8o+  =$K M%x# s02'6J$O6"&qHf-(.mW%{ASu)q ! &*64 'J1)^]NL'ri^Aag$ s9 8> F/ FaQ@+'B[ t6Oj@F)r n*%-E{=w7o+V )+' SC%X : t6k3 = 5C 9D*NQ `u?M,@ +&k~ar,c 0avF#'}  Ch4u cES[X] lL K 4= &iA+_#@`AQ +%+ //4Z$ %?[G~#p (*9" cs!8;  pE+78)" DP2^ $%}2AH7a{=Q.;8 QF, RX@. N $^\&B  Z= m/K NL'u8 ch))4O$h0G;G\ 9\i5%,3  5  P +7MsF#Z +'W96LL a*D^ m=b F'/ ,"@^ p, $F0 u  Woj : .(;$1$k*P 4 zb2<xC : #  2 W^k !?O;\6!!B.3 U-LKB;B/;4,- & &lſL) 0 ^SK>`Q(F>GE.|F P- ! !+  P";ca 53 1!# x i i:oi&w  bp).vz.B6)e*%O#[DI":57N$C$4 9 ;.SUD PH43,s (5*PN  KB#-^3  &6  ]&6+K#-AQ>>%: i vwi@k0oLi,'c731a'3 _2] 0A'6 u6S '4PD.@r!q#  VC=+' 0"# 8 KDOT A$L! 2-P c&c65 ; U  +'g[JRD. o+w/y,Q) @ -.3c a@Wt)/;*( *pe+.: y4̄9^ 'm I6 0Fx': % . uK!%0Q *:Rk6+& Ɣ4IJ ; o+/  :j 4HO~JV  ] +' ?|!   NF ; ,!70 !# &6 - /= !3? 5  +GG[;" f#@.Q k]'<T8M [!dT   +O e=Ix6_:/aP %`y3E6Nf-'x*; R-/@}&G  s;6T_S1 0arUO o+f D{~jw $  (yL' cJ$V"Nl(HgFh9 f+;J .YU%9 <% N";  bn`[C4D5")'1$UG# # E," ) 6)  5 CD81]<#Ҟ{=q# . Iw dRw7!# j 0VZ!0 )A)a#Q= !:-   3P =;  *NS \49C!@ {j!w Mb2nQF "e #G@ 2@b$]$c_Dcng /D 3Khv2 c%!:o+W<)Rj2NrC(4 9;g,Mz &HE~O!*U+*g=b+Cj>  U m2A) 2/2 ! yL' " &8) 4; jV t2*LV8% 7Y/  4! > !5]bP =K  DPKE :7{V iCk'd: ) i05-='-.Fp2FDh+}_J8!w, G~2A 0>FR; @  ON !%7 X=) 6v~Ly +':2."Q5(4d9!\ 8,\,4/5 fh;CNU V! >iJ/nP ( 9 Z tBOk?t!&0E0 %0:10 , !.^_0Nj2#slacn G =7Y':H0 V /  6^ F\!h " U\- OtsPj݌,ne1 O:;0HJ] dE#k( o=7UVYF 22%: ݂ )  8t (D fHN 7o1MR[ r  '_`IG dAI<^8-]0 }A ?n@8[  *"@+,y8Kad /%2J$zFQ%:2: @A6"K2:E%:@r k s87qcs$ 8':* \iہ[MR6  G %-) e $sbK>788j0W /<'>8zvf! ?<_6 ! "4  N *;K8>" O @.-/K' Db.>r<.{O l<2 :`2G3:' #0 2 $ qQQ \$% % g .33$.  & Vq7O$5*v+@>< Y~>. b@.IT uszgI7Y @O:?:2[ ?  ?  , ;M e8<[ RvotXJ  <__n  %B$xLP INC;.*4 " 5SDh -݉(K& $C((5kC5& o, z =7` /Z'|O|e%0g  $^ &0/9  * 5 #LKNI`Fkk0@$%%|OI#A! H )^1$!# :}#C}0D&G 6. x+' q11кX[& Y)P9boi   + 6P} x+/: }qox  [D gS- $%E& ^y "-K %8F!0  [ V7A8V>WeOJ$@"D /(9D$U u 45C Sh*!y)(%P%- .&<. < J$R 8H.K % 4 V-.)d(W( BY,27  $ 511 t< < >B Y+  +& IT>wA,*U J3I?u :W ??l, %<)( gCJ =-3% 9 P4 iJ[_!w,O B%/L1,O_)< \J-.T]8s ~=Uv~K v  S*MG* t% . !oL'1 !#KFv5.3C$R fo+3ftߵ. -'-:G$T5 ) ) ) )(((((( (( ( ( ( (('('((('(((((((('''''''''''(((((((((((((((((k(m(l(p(q(n(o(|(}((((~(g(j(h(i(e(f(y(w(x(z(t(v(u(r(s({())))(((((((((((((((((((((((((((((((((((((((((( ''''''' ' ''&&&&&&&&&&&&&&&&&&&&'''''' ' ''''''''&&'&&'&&&&&&&"'&'%'('''#'$'E'G'/'4'5'3'0'1'2'F'&&&&&&&&&&&&&&&&&&&&=';'<'B'A')'+'*','.'-'@'>'?'6'7'8'9':'' ''!''''D'C'I(J(D(E(A(B(C(F(G(H(a(N(K(P(Q(O(L(M(d(Y(W(X(Z(\(]([(S(U(V(T(R(b(_(`(^(c('''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''((((((((((((())H'I'O'N'S'L'M'K'J'R'P'T'Q''n'm'r'o'p'q's'l'''''''|''}'~'''t'v'u'w'z'x'y'{'''''''X'U'V'W'`'^'\']'Z'['Y'_'k'j'i'a'd'b'c'h'e'g'f'''''''''''''''''''''.(/(1(0(6(5(=(%(&(((!((( ((("(#($(8(7(>(?(9(:(@(<(3(2(4('(+(*(,()(((-(;(((((((((((((((((((((((((((((((((((((((((((((((((((((()))))))(() ))))568;9:3427#$%! "aRUVSTcIGHEFYWX  bJKMLOPQN   _^n|~}xzyoqsrptwvu{\kmlfghibecd_a`^]j1-+,&'(*)0./`]\><@BACD=?[Z      !OKLMN,#"*+&'()%$-RPQFGJHI[ZXWYtsvzwxyouqrmnpijlkNPOQRSTUVefbdc[\]ZYWXh^a_`g{|~}BCEDA8670/.34125VU@?;9:=<>STh i j g P S Q R Y Z K N O L M V T U ; 6 7 9 8 : < = > G I H J F X W ) + * ( ' " # % & $ 3 2 / , - . 4 5 0 1 ^ _    !        ? D A @ E C B [ \ ] m k l                 . 2 3 1 4 -                    % & # $ "   ! 0 begfdcopnvqsrxhmlkjitu[\]_a^`yzw      / {|~}+ , ( * ) ' y}|{z~xwjikfdeghtsrlomnqpuv     70123+()*'98,-/.546 !"#$&%QIHFGSROLJK:A<=;>?BCED@PNMWYXTUVZ | }  ~ z { x u s t y v w 5 o f g a c b \ ^ _ ` ] i j h R O P Q S U T r m n 6 = ? > 7 8 9 : ; < Z Y [ V X W E G C D F @ A B k K H I M N L J e d p q l b ` a f c d e  3&('%),*+5-./4 210#!"$baecdlkih^\][_`fgZYXRSTUVWjA?CB@HQPOEDFGKIJNL>:6789;=<Mq|}~w{zxyuvstr    uvxwtnqsrpmozy}~{|stplmr]XUWV\ZY[^_nofde`acbghikjq      *-+,7231%'&()0/.!"$#546]^TUSVYOQPRN_[a\ZWX`obigmfdehcjknlM89:ED;?C@BA>=<FHIJGLKrsptquwvu~}{|yxz      !ZYUTVaJHILK`]c8BFCDEG9=:>@?;<AbPSRQd_XWMON[\^213,+/07%&'(.-5     *) "!$#64~qz}|y{wvxrstupokijfehgmlnvw{x~|}zyTQPLMNO7521./0436FEDABC>@?<;8:9=S+,-&#"$%)*'(KHGIJR"""#"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""#""""""""""""""""##""""""""""""""""""""""""""#"""""O"W"R"S"P"Q"Y"X"V"U"T"}"z"{"|"_"^"\"Z"["]"""f"k"g"l"j"h"i"s"r"u"t"y"x"v"w"""""""""!!!!!!!!"""" " """""" """""" " ""-"+","."*"("'")"0"/"4"1"5"3"2"!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"c"e"d"`"b"a"6"B"A"@">"?"="<"7";"9":"8"I"J"D"C"N"M"L"K"H"G"F"E"""~"""""#"&"%"$""""""" """""""!"p"m"n"o"q""""Z$!$$$$ $1$0$$$$###$####*$)$$$$$$$$$5$($&$'$3$############$$$$$ $$ $ $ $ $############$$$$$$2$#$"$%$$$,$+$4$-$.$/$a#_#`#P#Q#R#N#O#f#e#g#Y#Z#W#X#k#j#w#o#n#r#t#u#G#B#C#D#H#F#E#@#A#?#>#;#<#=#:#'#)#(#,#-#*#+#9#8#3#4#5#7#6# #"#$#%#&###!#1#2#/#.#0#\#]#^#[#s########### # # ### ## ##########d#c#b#h#i#T#S#U#V#m#l#J#L#K#M#I#q#p#v#E$B$G$F$H$D$C$>$=$;$A$?$@$<$:$9$6$7$8$O$J$K$I$M$N$L$#################################################y#x#{#z#}#~#|##################################################[$X$Y$W$T$P$Q$R$S$V$U$/////////////////////0 0 0 0 00000 000000!0#0"0000 000000y/r/s/t/a/_/`/c/b/^/e/d/h/g/f/k/m/l/j/i/x/Z/W/X/Y/[/\/]/w/{/v/u/z/o/p/q/n/V0/0100030204050C0G0F0D0E0////////////////////////R0P0Q0%/$/,/-//////!/ /'/&// / / ////////////../..................// / //#/"////*////)/(/+/////////////////////////~/////|/}/////////////////////<080607090;0:0//////////////////////////////T/K/J/I/F/H/G/O/M/N/L/B/A/@/E/>/=/?/C/D/U/V/S/Q/R/P/8/./2/0///4/5/6/3/1/7/0A0B0?0N0O0L0M0X0W0U0S0T0-----------------~-------|-{-}-----------------x-z-y-v-u-p-r-q-s-t-l-m-o-n-c-i-k-j-g-h-e-d-f-w------------------...------.----------------------------------------------------------------....---.................g.h.c.d.\.[.Z.f.k.i.].^._.a.b.`.T.W.V.U.Y.X.j.e.......w.|.y.x.z.{..~..}.l.m.p.n.o.u.v.s.r.q.t.\.......................................P.L.S.'.%.&.(.*.+.,.).Q.:.6.7.<.;.9.8.-.2.3.4.5...0./.1.M.N.".$.#.!. ......... . . . . ...........G.F.C.E.D.O.@.=.B.A.?.>.R.H.J.K.I."-!-%-$- ------------ - ---------- - - -----#----&-,-'-(-)-*-+---.-/->-=-0-3-1-5-4-2-A-:-9-;-<-B-6-7-8-?-@-U-V-W-C-M-L-I-J-K-G-H-N-O-F-E-D-Y-Z-X-R-T-Q-P-S-`-^-_-b-a-\-]-[-..............................................! "#?>=<D./,-+B6587     C20341&$%'*()A@;9:OQPNmlnogkjhi}~{|A\][f^cb_`LKQSTUOPRCBIDEFGHJMNZYXWVdeazyxwtuvrpqs867<;0512349:>=B?A@FEDCLMGIHJK0132     <;78?@>:9%$#"! '&(*)-/.,+=645WVXmkZ[Ypo^]\lUTRSEIHFGNKJLOQPMnegfjdcbaih`_sqwtuvyx~|}z{r     ,/+(&'-*)! %"#$.TRSihabdc_`\^]geflmkj'F?>A@CB1,/-.+()*032E9:84567D=<;&%# "!   $  Z[QRSTUJKIGHWVLPMNOYXxwqnpoz{rvstuy|~}6875+*&'()A?@JI><=GFH     %$#" !;9:.0/-,CBED4123~}WX[\]ZTUSRLMKONPQYVnm_^`jklihgfedcabzwxy|{qtvusropklmjhigfbcdeuxvwt$! #"YUVWXZ-%*(&')/.,+srqpno[\]^a_`LQPMONTRS?@AB:<;>=   7432105698CIHFGEDJK~  y{|z}N4M4Q4O4P4m4l4^4[4\4]4j4i4`4a4_4b4c4d4V4U4R4S4T4:4<4;434449474&4/4041424.4,4-4+4(4)4*4'4846454k4I4G4L4J4K4H4 4 4 4 444444!4$4"4444444444444 44%4#4f4e4D4E4F4=4?4>4@4A4B4C4X4Z4Y4W4h4g4111111111111111111111111111111111111111111111111111111111111111111111111111111111222222222212$22 2#2111111111111111"22222 2 2 2 22 22222222222!2z22~222{2}2|2W2X2P2O2S2N2M2U2:2;29272822262523242H2J2I2G2C2B2E2F2D2V2=2<2?2A2@2>2%2&2'2)2*2(21202-2,2+2.2/2T2R2Q2L2K2u2t2w2h2i2j2k2g2x2b2d2e2c2f2]2[2Y2Z2_2\2`2a2^2v2s2r2q2p2l2m2o2n2y2ust}~yz{|vxwUXVYW_`rZ\[acbdfeopqghimnjkl]^   ! "         [ # + $ % ( & ' / 0 - . , * ) \ J K H I ? A @ = ; < >     2 1 3 5 4 : 6 7 9 8 V T U Z            M L N O B D C G F E W X S P Q R Y !!!!!!!!!! e c g d f n k l p o b ` a ] _ ^ i h m j  s q x v u t w r | } ~ z { y !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !! !!!! !!!!! !! !!!!!! !! ! ! !!! !! !*!)!%!+!&!'!-!,!$!#!!!!"! !!(!F!=!!E!D!@!A!G!C!B!6!9!;!:!8!4!5!0!1!/!.!3!2!7!O!H!I!J!K!N!L!Q!P!M!W!R!T!S!X!V!U!Y!Z!!!w!t!u!v!!q!r!s!p!!}!{!|!!!~!!m!l!n!o!i!h!j!k!!!e!d!g!c!b!`!a![!_!\!]!^!f!y!z!x!!!!!!!!!!!!!!!!dbcNQOPRTS_a\Z[^]XYUVW`132#$%     0(*)'&+,-!" ./wxutspoqrjifehgknlmv4GHCDKJFEI<?@BA5:6789;=>MLyz{|}~B6789:@<;A?>=utvqrsywz{xmnpokljEDCJFGHKLIhabfgcedi54312*+,0)'(./-     "#&$! %WX[\]YZ_`^USTQNMVPOR~}|     koplqnmbc`a\]_^yvwxrsutgjhidfeGEB?>CD@AF=+,- "!#$%(&')*}|z{HPJIMRQNOKLV[YZXWUTS54.032/176;9:<8~~}|oxy{zpqsrtvwuVTUW`KNOMLSPRQZXYGDEFHJI]\[^_:89BC;<3/012.*+-,@ !$#"A4567>?)%&'(=     \]_^i%$ "!#dcfeJLNMKO&-/.3'(+,)*01452IHEDACBGFQPRSTUjk`abV[ZYWX@?>8967<=;:  nhglmtsxyvwrqufgijabcedhonplkm}z~|{     ?&'$%,(! #")*+:789<>=;5.-0/43216YWXV[Zefdhg@ADEGFCBacb`_\]^TUOPSRQKNLMJIH xsqrvukjimlonptz{|~}yw    FHIKJGEDgXWTUV+-,(#" !%$'&)*LRMNOSPQh`]^_.87:;65493/012i     jdbacBCA=<>@?kY\Z[fetwxuvzysnmlopqr{|}~vyzwxu}{|~.1/0BC*-+,234>@A78?<=569;:)%&" !$#'(DnomtKFEGNMJHIL^\]Y[ZVURSTQOPXWrpikjldfhgeacb_`qsMD:9?B>=A@-*()$%&'" !#+,<;     65487/.0132CJKLHGEFI00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000|0~0}00000000000000000000000t0u0v0z0{0w0x0q0r0s0y0000000h0g0]0^0\0Y0Z0[0_0`0a0l0o0d0c0b0n0k0f0e0m0i0j0p011]1R1V1W1U1S1T1\1[1Z1Y1X1E1Q1F1L1O1N1M1G1H1I1J1K1P1j1g1c1b1^1_1`1a1f1i1d1e1h11111111{1y1z1|1x1u1v1w11r1k1o1l1m1n1t1q1p1s1~11}11111B1,1*1+1-14151<1=1D1;1:1>1$1%1&1)1'1(1A1@131112111 11111 111111111111111110001 1 1 1617101/1.191811111 1!1"1#1C1?111111111111111111333333333333333333333333 4433333333333333344333333333333333333333~33333|3}3y3z3{3v3u3x3w333333333333333333333333333p3q3g3f3h3j3i3S3P3Q3R3n3b3c3o3\3]3[3l3k3r3V3T3U3t3W3X3Y3Z3e3d3^3a3_3`3s3m3333333333333333333333333333333333333333444444$$$$$$$$$$$$$$$$$$$$$$$%$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$w$u$v$$$t$r$s$}$i$j$k$m$l$_$`$a$b$\$]$^$y$x$$z${$|$e$c$h$f$g$d$~$q$p$n$o$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%%$$$$$$%o%l%m%p%u%w%v%t%r%s%q%n%%%%z%|%{%y%x%%%%%%%h%d%`%a%c%b%e%j%i%k%f%g%%%]%L%N%M%K%[%Y%\%O%Q%P%S%R%_%^%X%W%V%T%U%Z%%%1%%%%-% %%%%%%%%,%+%/%(%*%)%%%%#%%%$%"% %!%&%'%% %%% % % %%%%%%%%0%.%~%%%}%A%B%F%C%E%D%2%<%=%?%@%>%3%9%4%5%6%7%8%:%;%J%H%I%G%%%&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&#&%&$&%%%%%%%%%%%&&&& & & & & &&&&&&&&&&&&&-&%%%%%%%%%%%%%%%%%&&'&"&!& &&&(&)&&&&&&&%&%&&*&+&,&&&&&&&&&&&&&&&&&&&&&&&&&&&&&%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%g&b&a&f&c&d&e&`&^&_&]&X&[&W&R&P&U&T&S&Q&Y&V&Z&\&>&<&=&@&?&7&8&6&0&1&.&/&5&3&2&4&;&:&9&N&L&K&O&M&F&E&G&I&H&J&C&D&B&A&l&i&j&k&h&&x&z&}&{&|&y&&&&~&&&&&q&n&m&r&p&o&w&s&t&u&v&&&&&&&&&&251505(5!5"5'5#5$5%5&5*5)5-5.5,5+555555555555 55/5_opjifhegrsqklmb`cdan|}xwvtu~{yz234/01.XUVW ;:78956OPNMQRST# !%"$    \FGHED[+&)'(-,*KLIJ]^<=ACB@?>ZYQFEDC$#"! O(%&)*,-+'MPNHIG     RTS@?ABLJK8659:71243/0.;<>=?5867$#%(&')+*,-41./0239:;<=>`YXZba[\]^_TWVUSfgjkcedhopnlmqi@ABCEFDNPQRJIKLMOHG!     " tru}yvwxz{~|sxyzwstuv_a`]UVWZ[\YX^}|{~hgjifdecboqrmlkpn             ) * " #      T W U Y \ Z [ X V ~ } z n m l y a ^ _ ] ` b | e f c d g w x t v u p o { j k i h q r s  ( ' &     % $ !     V Y P Q W O N G F E R S T U M K L X H J I b c a ] Z [ \ k j e d f ` ^ _ g h i s u t { p r q w v n m l o | y z x < B D C A ? / + , 0 3 1 2 - . 6 4 5 7 8 9 = @ : > ;  } ~  ~ z { } |                 ; = < 6 2 3 . - 7 8 ( ' % # $ & : / 1 0 * ) , +           " ! 4 9 5 U T Q M L S F C D E @ A B ? > H I G O N J K R P n m i h r s o j k l t p q y x v u w V d e g f a [ W Z X Y \ _ ` ^ ] c b JIBA3456@>? <;=O78:9       (*$"#!&)'%CDFE/012,-.+LKNMHGaZ\[VWYX_]^`3/06452189<=:;7IHDCB>A@?GEFhgbcedfacbhed_`^fgiyuvtwx{z|}~jlkpqrsnomSPQTYZX\][WVURpo q s r p o n | z { ~  x w y t u v } 5 7 6 ; : ? 1 . / 0 , - A @ 4 2 3 < = 9 8 >                     ) + * & % '       # $ ! " ( P L K O J I N M H G F B C D E Q R S      jik&#" !$'%,*()+.-SRQJKMLPNOUTmlnW+X+V+U+l+`+_+^+]+g+e+f+d+&+++'+(+)+,+*+0+-+1+/+.+%+#+$+!+ ++++++"+D+J+I+H+F+G+E+7+6+2+3+:+<+4+5+9+8+;+k+c+a+b+ + ++ +++++++++++++\+Y+Z+[+O+K+L+P+N+M+@+B+C+A+=+>+?+T+S+R+Q+i+j+h+,r,q,n,o,p,,,,,x,y,w,,j,i,l,m,k,s,v,u,t,c,a,d,e,g,f,h,b,},,~,,^,],_,\,Z,Y,X,R,U,S,T,V,W,`,[,{,|,z,,,,,++++++++++++++++++,,++++++++++++++++++++++++++++++++++++++++++ , , , ,, ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,++++++++++++++++++++++++++++~++++++++++++++++++++++++++}+{+u+v+w+x+y+z+r+m+n+q+o+p+t+s+|+++++++++++++++++,,,$,,,,,,%,,,,,, ,,,!,",#,,,<,;,:,9,3,4,2,5,6,8,7,0,.,*,+,),&,',(,,,-,/,1,O,L,K,H,G,J,I,M,N,D,E,F,?,@,A,=,>,C,B,Q,P,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,N5M5K5B5C5D5@5A585453555957565?5:5;5<5=5>5G5F5E5H5I5J5L522222222222222222222222222222222222222222222222222222222222222222222222222283933363735343,3+3*3-3(3)3$3%3'3 333#3&3!3"3 333333333 3 3 3 33333333303.3/32313322222222322223332222222222222222222222232222222233222222223D3C3B3A3I3@3?3:3;3<3=3>3J3F3G3H3E3O3M3L3K3N3*h*i*g*f*k*j*c*e*d*a*b*`*_*Z*[*\*]*^***y*|*z*{*t*s*r*q*3*2*1*0******** ****8*:*9***)*%*&*"*$*#*!*'*(*;*7*+*,*/*-*.*5*4*6**x*u*v*w*O*N*B*@*A*K*I*J*H*G*>*?*<*=*D*C*F*E*M*L*n*p*o*m*l*Y*R*P*Q*X*V*W*U*T*S*****}*~* *** * * *** ***)))))**))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))**))))))))))))))))))))))))))))***************************************************)))))))))))|)})~))y)z)x){))))))8):)9)<)=);)N)M)E)D)C)B)?)>)@)A).)/)1)2)0)3)7)5)6)4),)-)#)%)!)")$)))) ))))))))))&)()')+)*)I)H)L)K)J)G)F))))g)i)h)V)S)T)U)[)])\)b)a)R)O)Q)P)c)d)f)e)X)W)Z)Y)`)^)_))))))))))u)w)v)r)j)q)k)l)m)p)o)n)s)t))****************************************************************++++++++ + +*************+R5P5O5Q5444444444444444444444444444444554455555555444444444444444444444444444445 555 5 5 55 55{4|4p4n4o4q444444444s4t4r4v4w4u4~4}4z4x4y4444444444444444444444444444444444444444444444444444444444444DEIHGFLMNOPQRTSUKJ`efijghacbklodmntvusrxwqpZ^[]\_zy{|}~?@BAWVYXC`efhgiljkabdcIHFGED[_Z\^]nomqpwxvuRQSTOPNMy|z{strWYX~}LKVJU      /.012%'()&*-+,543!" 9$678#               ! + * # $ "   ' ) ( % & . , - / 5 4 3 0 2 1          A@CB<;=> ?:6 ` [ ] ^ \ _ f g e d T V U c b a X W Z Y P S h R Q o p q n m w x v t s u j l k r  { | y z ~ } i ! ! ! ! !.!/!0!1!2!3!,!-!%!&!+!*!$!)!'!(!7!6!5!4!< ? ; > = G H F B D C 9 7 8 E I : A @ !!!!! !!!!#!"!!!!!!! ! !! !!! !!!!! !!!! N M O J K L >!"P"O"Q"E"F"D"?"B"A"@"M"N"I"G"C"H"J"K"L"o"i"j"k"l"m"n"g"h"]"b"^"a"_"`"c"d"W"X"Y"R"V"U"T"S"""""""Z"\"["r"q"p""""" " " "!!e"f" "=" "t#u#s#v#w#r#q#`#c#g#b#a#d#f#e#j#i#h#n#m#p#x#o#l#k#O#P#Q#S#T#R#\#]#X#W#_#^#Y#Z#[#V#U#N#M#D#E#F#C#G#B#H#>#?#@#A#<#=#;#I#J#:##~#####{#z#y#}#|#3#2#L#K#7#6#4#9#8#5##1#########0#%&$# !"(*+),'68;9:@?>7=<   .01/2-43  5ABQgbcdef`a]\^_YX[ZkjSUTihRWVwxvuyzqrstp{lmnoMLKPQNORIJHXYW[Z\VUGCDFE}~|]^TS     0235461'(+*)$,-./&% "!#qrposyz{tvwuxVXYZ[W]^\_STU;<=?>9:8AB@7QOPIJRKMNLGMFNHJIKLjkhig}~adebcmnlPOEDC`|f      !zywx~}|{17856:9432A@<B>?=&'()"%$#CED,-KL+*0/JIH.;FGMefdbcagh`klmjponqrstvuWTUVSZ[]\OPQR_^iNYXZ[\_]`^DIHEGFRWVUTSLJKNPOXYMcQabrsutv}~opwxqlz{|kymn:<;?=>95678.0-/231ABC4,@     ! hgfied'()*&$%"#j+'+,-./0(*)<=>9:7;8ABF@ECD !#"465213HG?K%&IJ$RSQPOMNWYXUVLTZ     [`_^]\arsutvqwxy~z|{}ilmjkcefdopnghcdbfgheb_`a............................................../././///../ /..//.........................................................."/#/'/&/!/%/$/,/+/1/-/./0///6/3/4/5/2/:/8/;/9/B/D/C/?/@/>/+?+@+9+:+;+<+=+8+A+5+7+6+***********+++++++++++*++++++++++++++++++++++++++******+++++***********************+++++++**++m+l+k+**0,1,6,7,/,2,4,5,3,9,:,8,;,<,=,@,B,),>,A,.,?,-,*,,,+,+++++++++++++++++++++++++++++++++++++++,,,, ,,, , , ,,,,,, ,,E,F,C,D,G,I,H,J,K,L,N,M,O,Q,P,,,,,,,$, ,",#,!,&,%,',(,++++++++++++++++++++++++++++++,+,++,,,,,,,++++++++++++++W,Y,X,V,Z,[,T,S,U,_,^,],`,\,b,a,c,d,R,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,--,,,,,,,,,,,--,,-#-%-&-$-- -!-"---(-'----------- - ----- -)-+-- - -*-----:-9-6-7-8-3-4-5-2-=-;-<-@-A-0-/-?->-C-.-B-1---,-V-]-_-`-^-\-a-e-d-b-c-[-g-f-W-X-Z-Y-G-F-K-L-M-E-D-J-O-P-H-I-N-T-S-U-R-Q-,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,m,l,g,h,i,j,p,o,q,f,e,k,r,n,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,},~,,,,,,,,,,,y,{,z,|,,,,,,,t,s,w,x,u,v,,,,,---------------------------------------v-y-x-|-{-w-z-}-~------s-u-t-------------------l-m-n-o--------q-r-p-k-j-------i-h------9.:.E.8.;.D.C.B.>.<.=.A.?.@.... .........*.,.+.3.1.2.-.../.0....... ..".#.&.!.%.$.I.H.G.7.5.6.---.... . ..... .4.'.(.. .F.).s.r.y.x.v.w.q.u.t.k.j.l.i.m.n.g.h.{.|.z..~.}.p.o.Z.[.\.Y.c.e.d.b.`.a._.^.].f.V.X.W.Q.R.O.P.L.M.N.K.U.J.S.T.................///////////////////////////////////////z/|/{/~/}//////x//y/////////////////////////---------------------------////////////-------------------//////..<JHIFGADECB>?@=KLM !   +4,5-/2.130)*('&%$"#XWVUYZTPSNOQR_^`]6:987  \[ab;u~}|yz{vxwqrstnomjklhgifpdceonqplmkjituxswv~{z|}yr  ~ | } K M N O P R Q S T L V W U 9 : ; < 8 b ^ _ a ` H I J G ] Z [ \ d c f e @ A B C Y X 7 6 E D = > 4 3 5 h F g ?                  # % $     " ! & '  (     q p o m n s r j i l k 0 . / ) * 1 2 - , + { y z x w t u v                         " $ ! # & %   '  8 9 ; : 0 2 1 3 4 ( * + ) 7 6 5 / - . = < > , b c d g o n m h j l k i f e p t q r s v u a J F H G I C A B D P Q E O L N ? @ K R M T \ Y Z X V [ U ] ^ ` W _ S y { w x z | / 0 2 8 7 1 5 6 4 3 & ' ( ) % > ? @ < =    " # $ + , * : 9 ; A ! . -                        L D C G F I J K E B H s r t u q x y v w n o p X Y Z W V \ [ U ] T i k j h g l d f e a b c ` _ ^ | { } ~ z P Q R S O N  m M   ~ } nvrsutwxypoqzfghieab`c~}jlkmd{|_]^=KLMJFHIGNEPOUVWXTRS\[Z@?BADCYQ>     $&%"#! ()'-,*+ 68721/054:93.-/5623917804,*%+&(')>=<;A?@     !"$#.:<;     lkghijfednmcvyzx{w~u}|pqrsotZ[\]YXVWURSTb^`a_r~z{|s}tvwuyxihjcdgefnopqlmkEFDIKJMLGHCBTUVWSRQNPO^_]YZXa`b\[#!"%$&' )(/.0;<:987654123-,KLEJIFHG@AB?DC  NOPM+*=>  Q jklihgefdcb')*(%$&#GHIFDECB[aZ`\_]^OPNJKMLSUVYTWX6:798?@>A=./0-,2314 "!mn;<5oRQ+qvwxstu|{rzyp     }~{|z !hgdfe`a_bcKLJONQPMR$#*)%("'&WYXUVTZS453.210/nmjkil^[\]proqxwy,-+vutsz{yuvw~|}xstrqp789:;>=BA@<?6_^]abcf`dehilnmjkgoTRSNOQPFGHDCEJMIKLVWXUZY[\#$" !%/0.1&'()*+-23,9<=:>;786C5AB@?NSTUORPQMWLVKGJDEIHF  YZ[\_`]^   4Xastvuqropgjmlhik|}~yz{xefwnd   " !%#$  '&()468957=><2301:;/.-*,+cb)=*?*@*>*B*A*D*C*G*F*H*I*J*K*E*;*:*<*L*9*S*R*P*Q*X*O*Y*T*V*W*U*2*4*5*7*3*6*N*M*[*8*Z*))))))))))))))))))))))))))))) * ******************))))))))))))))))***))* *)** **** *]*i*\*^*a*b*c*`*d*e*h*_*g*f*)))))))))))))*#*$*"*&*'*)*(* *!*+*%***t*u*v*{*s*y*z*w*x*o*p*q*m*l*k*j*n*r*)))))))))))))~*******)))),*-*.*/*))**}*|*1*))0*)(((((((((((((((((((((((((((((((((( )) )))))))) ) ))() ))))))(((((((((((((((((((((((((((())))"))!) )(((((((((((((())*)0)/).)+)-),))))))%)&)#)$)((((((((((((2)1)))')()(a(d(`(b(c(X(V(Y(W(U(T(](^(_(e(R(S(\(Z([(((((((((((((((f(g(h(i(j(k(m(n(o(p(l(r(q(#($(%(&('( (!("(y(|(}({(~((z(((;(9(:(5(6(8(7((((((((((((((((+(*(,(-((()(/(0(1(2(.(3(O(P(Q(M(N(A(B(C(@(D(I(E(H(G(F(t(s(v(u(((((=(>(?(<(((((((x(w(L(4(J(K(])Z)[)\)U)V)X)W)Y)L)M)N)T)R)S)O)Q)P)E)F)^)I)K)J)H)G))))))))))))))e)f)d)_)`)a)i)h)g)c)b)n)m)o)s)r)q)p)l)k)j)v)w)})u)x)y)|)z){))))))))))))))))))))))D)C)B)A)))))))~))t))@))))*******************************************************************:)<);)=)>)8)9)?)7)4)3)5)6)*********~}zy|{vwx`abcd_efpnolmsrutjihgqkEHIGFLKMQJNPOCDBA435:89?>=^]ZYXWSUT\[V7@6R<;dxcfghejipqnomlrstkwuvyz{|}~`ab_     !"%&)(#$' .-*,+120/autwxyz{v|lk}~qrmsnopdbcfijhgeORSQPLKMNVWTU_`^YX]\[Z5:9876 !"#324>=()*+-,./<;$%&'01     CDBEA@?FJGIH     37465,-/12+0.#"(*) !$%&'@FEGDBACIH=<:;89NM?>JLKx{|z}~yOY[Z\UVWXPQRST^`acdbkj_ighefuvtwqsropmn]l     '(&%!# ")+*$,89:465;723-.01/<|xz{y~}w     2456301/.,+7-&%'("!#$:89<* ;)GOFHNMIJKLQPRDECVXWYUTS>?=AB@\]Z[^`_noqpmkljritsuvdacbghfe?@>AEFDBCHIG=d e f c g a ` b [ ] \ Z Y X _ ^ k j W m R T U S h i Q V l + ) , - * ( ' & < : ; = 6 5 4 8 7 9 3 2 @ ? / . > 0 1 A H G I F C D B E K J M P O L N u }  ~ | { y z x w v     r t s o q p                     ! $ % #  n  " ^ _ ` a S T U Z X Y I J K L V W R P Q [ \ ] b c M N O 8 > 9 = : ; < * , + / 0 - . B A C ? @ 3 4 5 7 6 2 1 ) & ' ( % $ " #    !   s o q p r   j i k l     G D E F    f e d  g h   n m   u t  H   v      ~ x } | w z y {   %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&& &&&& & & & &&&&%%%%%%%%&&&%&&&&&&&&!& &&"&&#&&&&%%%%%%%%%%%%%%%%%0&1&2&3&.&/&%%%%%%%%%%'&(&&&$&%&%%%%%%%%%%*&+&)&%%%%%%%%%4&-&,&&&&&&&&&&y&&}&z&~&&|&{&&&&&&w&u&v&&&&&&&&&&&&&&&&&x&&&&t&&&&&&&&&&&&&&&&&&&&&&&&&&a&^&`&_&e&g&f&i&h&o&p&n&m&l&c&q&b&d&]&k&j&Q&R&T&S&P&U&Y&Z&O&W&V&X&6&7&@&5&8&?&=&>&<&9&;&:&H&G&D&F&E&&&&&B&C&A&I&J&K&s&r&&&L&M&N&\&[&]'^'_'\'['Z'`'T'W'U'V'b'a'c'Y'X'd''''''''''z'|'}'~''''{''''''''o'j'k'l'n'm'v'w'y'x'u't'h'i'e'g'f''''''p'q's'r'Q'R'S'P''''L'K''N''O'M'J' ''' ' ' ''''''' '''''&&&&&&&&&&&&'(')'*'''"'#'$'%' '!'&&&&&&&&&&&''&'''&&&&'''''&&&''''+','-'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''6'7';'5'8':'9'/'2'1'0'4'3'<'.'A'B'C'@'G'F'H'I'?'='>'E'D'&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&'''''8>?@=;<A9:CDBE673/12045G.Fjiknompqrlhgsf_ab`e]cd\^HNOJIKMLUZ[WVYX&,'()+*ST-tPQR()* !#"$&'%   +     $"# !%MNIKLJ<>=AB?@VWSUTPQORXCDHFGE$%'&#"./,-()+*0 !74563120/:89.-;,     ihgefa^`_cb]d{|}~xyzuwvmlnopkjsrq3245:89176xzy|{wt}vu~BC>A=@?HGDFE<;\[ZY4 4 4 4 4 4444444434444444433333333333333333333333333444444433,4.4-4+4#4$4%4"444346454&4(4'4849474*4)4/40424144!4 4G4I4J4K4N4M4L4H4F4O4P4C4E4D43333333333@4?4B4A4>4=4<433333333333333444Q4:4;483N3Q3S3R3V3X3W3U3T3Y3P3O3B3D3E3C3H3G3K3J3I3F3L3Z3\3[3:3;393A3@3]3<3M3=3?3>33333333333333333333333~3}3333j3k3`3a3_3i3^3c3h3g3b3d3e3f3p3q3m3n3o3r3s3t3w3l3v3u32313534333x3|3y3z3{333333'3(3&3+3)3*3.303/3-3,373633322222222222222222222222222222222222222 3 333332 3 33 3333333322333333333322222222222222222233333222222222222$3%3#3222 3!3"32n4m4p4o4x4y4w4t4s4l4k4v4u4z4{4r4q4444}4~4444|4444_4`4]4^4Y4Z4[4\4e4f4g4h4d4a4X4b4c4444444444U4V4R4S4j4T4i44W4333333333333333333333333333333333333333333334444444444444444444444440000000000000000///////////////////////000000 0 00 00.0/000*0-0+0,0/0/////%0&0)0(0$0'040302010////!0"0#0 0////00 0////705060 0/2131516141118171+1,1-1.1/101*191)111111111111111111 1 1 11 111 111E1F1@1B1A1D1C1000000"1#1%1$1&111 1!1H1I1G10000;1:100'1(1=1>1<111?1010000000000000000000000000000000000000000q0r0s0t0w0x0v0z0y0u0{0}0|0000000~0000000000000000J1L1K1Z1[1O1N1T1V1U1`1_1R1Q1P1W1X1Y1\1]1^1M1S1q1r1s1p1n1o1t1u1m1v1l1w1g1e1f1h1i1k1j1d1c1b1a11111111111|1{1~1}1z1y111x111b0d0e0c0f0g0a0`0_0i0^0\0[0]0h0P0V0O0Q0R0T0S0U0G0F0J0H0I0;0<0=0:090K0N0M0L0D0B0C0l0j0k0W0Y0X0@0?0n0m0p0A0E0Z0o0>000000000000000000000000000000000000000000000000000000001111111111111111111111111111111111111111111111111111111111111180      '&$(%#!"0./*+)-,zxyuvwrst|{~}     8;:9=<.-,234756*+?/()1>0PQSTRYXWZUVFIHJKGOMNLDC@AB'#$%& "!EHGFDECIBJKVWUXYTS:9;<=>8OPNML[Z]\A?@234QR6715^[cbd`a_efgh^]onlmkqpjrsiwx{}~|yzuvt7:9?8>;<=@6DBCA,+-)('./* "!&$%#534201KLMJNOP>:;9=<@?CBAHGDFEYVWX678TSQI5UR     u|}~vxyw{zlhijkgtsnmropq     ^_`ab\][ZYTXUWV#$ %"!&('1243,0-./)+*QPMLSRONKIJ[]\_^`adehcfgbefdcEFHGklijpqoZnm$$ $$$$!$"$#$($'$&$,$+$$$.$/$*$$$-$)$%$0$$$$$ $ $ $$$ $ $####################$$$$$$$$$$$$########$$#######################################################################################$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$|$}${$~$$$$$$$$$$$$$$$$$$$$$z$$$?$A$F$G$H$I$J$B$E$D$C$K$@$4$8$9$7$5$6$>$=$<$;$:$3$P$Q$R$S$O$N$V$W$T$M$X$U$L$j$l$m$n$k$q$p$i$r$o$e$f$g$d$a$b$`$c$u$s$t$_$^$]$x$w$[$\$h$v$Z$Y$$$$$$$$$$$$$$$$$$1$2$y$     "#'&%$(!/01.+*-,) BHJKLIFGNPOMCED<=:;96758ZYVWX[TUa`_\]^423edSRbc?@fQA>|~}z{ywxutrqsvopglnmihjk111111111111111222222212211 21111122 2 2222 222222222 222$2#22 2!2"22%22&2+2-2,2)2*2(2'2.202/21211t2y2{2}2z2|2w2v2x2u22~22222222222222222222f2i2h2g2e2d2j222222222o2p2n2m2k2l222q2r2c22s22I2U2R2S2T2M2L2O2N2W2X2Y2V2Z2[2\2]2K2P2J2Q2C2D2B2G2H2E2?2@2F2A2=2>2;2:292<2_2`2^2b2a2428272526222322222222222222222222222C%D%E%B%Q%R%P%T%U%V%W%L%J%K%Z%\%]%[%G%H%Y%X%>%=%?%A%@%N%M%_%F%I%;%<%O%^%S%%% %%%%%%%%%%%%%*%+%,%-%.%)%%%%% %!%"%$%#%%%&%'%(% % %s%t%v%u%o%p%q%r%e%b%c%d%m%l%a%`%i%h%k%x%n%j%g%w%f%%% %% %%%%$%$%%%%%%%%%$$$$$$$$$$$%4%$$$$$$$$~%}%{%z%y%|%$$$$$$$$$$$$$$$0%/%1%2%8%7%9%:%$$$5%6%3%$$$%%%%%%$$$~}55555 5555555545555555 5 5 5 55 5!5"55#5$5&5%5*5)5+5(5555'555,55857565:5;5<595?555>5=5F5G5D5C5E5@5B5A5O5N5J5K5L5M5I5H5.5/5254535-51505P5Q5R5S5444444444444444444444444444444444444444444444444444444444444444444444444444444444((((((((((((((((((((( ( (( ( ( (((''11111111111111111111111111114444TITLTRIE_HWX,ERIRARSRRRORNRTRACRURDRRLRAMRHRPRIGREMENBRNMURFRD.MNORSISTHUH.CWRCDTCAGOOPERRSRNIRIIISEJSSAKRSSTLRTLSQLPTLPAGDGUWVONBNDCNSDNCNNNOOMMMDSOEMMPLPCLPPLQRLRLBRBKKBKJJSEBBEIEHSFFHTGTSTTFTGUAA.RUSUUGVFVVRVWWWOFSXYYYYZZa]n~Tx/60     &+,.06DJSbnp}1/#%+u*$(' &/ "X ^ !|! [CR*O\q * )  7} !  Ki, !&@1NP z-5/  7 R2ZX0#k-7=B+06  SZ I F8yW x ]9%"  HTv  * /C  &JMYp _${ w Pm9 34$GD:>I}Vi }H+ $" r4 "lyt%+6M  ~D4 , J![' d#W(Q*: )O  '  gSU/ #m+p &JL92 #)G-nIp?     $^6K% > /)as @?o 0 =/<+V. `:_ " ' h f#  . ; (  ). QF|(N> %8 )YF S)b&pJ5|3c?:';\ ]c  ="<E( U|%_ @ 5 8 jE1   2T A 3,  L;BA e   < ,()'&-,#! "$%.  *+678@0/129:<;534>?=RMNEDACBHGFQILJKOPShefgjinmlkbadc`[\]^_ZTVUWXYsutqrpoz|{xywv}~)>=?BC@AED21/0.-,3547698;<+:*" !$#%&'FG(yxz{tuv|}~w  KIJLNMOPRQH`bcda]^e_UWVTXSqpsrmnolY\Z[ikjgfhINITCAP